KEGG   Bos taurus (cow): 512928Help
Entry
512928            CDS       T01008                                 

Gene name
CHRM4
Definition
(RefSeq) muscarinic acetylcholine receptor M4
  KO
K04132  muscarinic acetylcholine receptor M4
Organism
bta  Bos taurus (cow)
Pathway
bta04080  Neuroactive ligand-receptor interaction
bta04725  Cholinergic synapse
bta04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    512928 (CHRM4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    512928 (CHRM4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    512928 (CHRM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    512928 (CHRM4)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    512928 (CHRM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 TAS2R DUF5427
Motif
Other DBs
NCBI-GeneID: 512928
NCBI-ProteinID: NP_001096713
BGD-bta: BT10897
Ensembl: ENSBTAG00000033699
UniProt: A6QQE4
Position
15
AA seq 271 aa AA seqDB search
MTVLYVHISLASRSRVHKHRPEGPKEKKAKTLAFLKSPLMKQSVKKPPPPGDTTARGELR
NGKLEEAPPPVLPPPPRPMADKDTSNESSSGSATQNTKERPPTELSTTEATTPATPAPPL
QPRTLNPASKWSKIQIVTKQTGNECVTAIEIVPATPAGMRPAANVARKFASIARSQVRKK
RQMAARERKVTRTIFAILLAFILTWTPYNVMVLVNTFCQSCIPETVWSIGYWLCYVNSTI
NPACYALCNATFKKTFRHLLLCQYRNIGTAR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctctacgtccacatctccctggccagtcgcagccgagttcacaagcaccgg
cccgaaggcccgaaggagaagaaggccaagaccctggccttcctcaagagccccctgatg
aagcagagcgtcaagaaaccaccacccccgggagacaccacagctcggggcgagctgcgc
aatgggaagctagaggaggctcctccgcctgtgctgccacccccgccgcgccccatggcc
gacaaggacacctccaatgagtccagctcgggcagcgccacccaaaacaccaaggaacgc
ccacccacagagctgtcaaccacagaggccaccacgccggccacacccgcaccccccctc
cagccacggaccctcaacccggcctccaaatggtccaagatccagattgtaacgaagcag
acaggcaacgagtgtgtgacggccatcgagatcgtgcctgccacaccggctggcatgcgc
ccggcagccaacgtggcccggaagtttgccagcatcgcccgcagccaggtgcggaagaag
cggcagatggcggcccgggagcgcaaggtgactcggaccatctttgccatcctgctggcc
ttcatcctcacctggacaccctacaacgtcatggtcctggtgaacaccttctgccagagc
tgcatccccgagaccgtgtggtccatcggctactggctctgctacgtcaacagcaccatc
aacccggcctgctacgccctctgcaacgccacctttaaaaagaccttccggcacctgctg
ctctgccagtatcgaaacattggcactgccaggtag

DBGET integrated database retrieval system