KEGG   Bos taurus (cow): 513131Help
Entry
513131            CDS       T01008                                 

Gene name
CTBP1
Definition
(RefSeq) C-terminal-binding protein 1 isoform X1
  KO
K04496  C-terminal binding protein
Organism
bta  Bos taurus (cow)
Pathway
bta04310  Wnt signaling pathway
bta04330  Notch signaling pathway
bta05200  Pathways in cancer
bta05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    513131 (CTBP1)
   04330 Notch signaling pathway
    513131 (CTBP1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    513131 (CTBP1)
  09162 Cancers: Specific types
   05220 Chronic myeloid leukemia
    513131 (CTBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    513131 (CTBP1)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Macropinocytosis
   Others
    513131 (CTBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 XdhC_C Cellsynth_D
Motif
Other DBs
NCBI-GeneID: 513131
NCBI-ProteinID: XP_024849526
BGD-bta: BT18769
VGNC: 27785
Position
6
AA seq 441 aa AA seqDB search
MGSSHLLNKGLPLGVRPPIMNGPMHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQ
EIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNV
PAASVEETADSTMCHILNLYRRTTWLHQALREGTRVQSVEQIREVASGAARIRGETLGVI
GLGRVGQAVALRAKAFGFNVLFYDPYLADGTERALGLQRVSTLQDLLFHSDCVTLHCGLN
EHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFS
QGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLAAAT
HWASVDPAVVHPELNGAAYSRYPPGVVGVAPSGIPAAVEGIVPSAMSLSHGLPPVSHPPH
APSPGQTVKPEADRDHASDQL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgggcagctcgcacttgctcaacaagggcctgccgctcggcgtccgacctccgatcatg
aacgggcccatgcacccccggcccctggtggcgctgctggacggccgggactgcacggtg
gagatgcccatcctgaaggacgtggccaccgtggccttctgtgacgcgcagtccacgcag
gagatccacgagaaggtcctgaacgaggccgtgggcgcgctgatgtaccacaccatcacg
ctgaccagggaggatctggagaagttcaaggctctgcggataatcgtgcgcatcggcagc
ggcttcgacaacattgacatcaagtcggccggggacctaggcattgccgtctgcaacgtg
ccggccgcatccgtggaggagaccgctgactccaccatgtgccacatcctcaacctgtac
cgcaggaccacgtggctgcaccaggcgctgcgggagggcacgcgcgtccagagcgttgag
cagatccgggaggtggcctccggagccgccaggatccgcggggagaccctgggcgtcatc
gggctagggcgcgtggggcaggcggtggcactgcgggccaaggcctttggcttcaacgtg
ctcttctacgacccctacctggcggacggcacggagcgggcgctggggctgcagcgggtc
agcacgctgcaggacctgctcttccacagcgactgcgtgaccctgcactgcggcctcaac
gagcacaaccaccacctcatcaacgacttcaccgtcaagcagatgagacaaggggctttc
ctggtgaacacggcccggggaggcctggtggacgagaaggctctggcccaggccctgaag
gaggggcggatccgtggcgcagccctggacgtgcacgagtcagagcccttcagctttagc
cagggccccttgaaggacgcgcccaacctgatctgcaccccgcatgcggcctggtacagc
gagcaggcctccatcgagatgcgtgaggaggcagccagggagatccggagagccatcaca
ggccggatccccgacagcctgaagaactgcgtcaacaaggaccacctggcggccgccacc
cactgggccagcgtggaccccgccgtggtacaccctgagctcaatggggccgcctacagc
aggtaccccccgggcgtggtaggcgtggcacccagcggcatcccggccgccgtggagggc
atcgtccccagcgcgatgtccctgtcccacggcctgccccccgtctcccaccctccccac
gccccttctcccggccaaaccgtcaagcccgaggcggatagagaccatgcgagcgaccag
ttgtag

DBGET integrated database retrieval system