KEGG   Bos taurus (cow): 513281
Entry
513281            CDS       T01008                                 

Gene name
CPM
Definition
(RefSeq) carboxypeptidase M isoform X1
  KO
K01296  carboxypeptidase M [EC:3.4.17.12]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bta01002]
    513281 (CPM)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bta00537]
    513281 (CPM)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.12  carboxypeptidase M
     513281 (CPM)
Peptidases and inhibitors [BR:bta01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   513281 (CPM)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bta00537]
 Enzymes
  513281 (CPM)
SSDB
Motif
Pfam: Peptidase_M14 CarboxypepD_reg AstE_AspA
Other DBs
NCBI-GeneID: 513281
NCBI-ProteinID: XP_003586115
BGD-bta: BT15327
Ensembl: ENSBTAG00000013496
VGNC: 27655
UniProt: A7MBD9
Position
5
AA seq 442 aa
MDCARLWLGLLMPAVAALDFSYHHQPEMEAFLKNVAQNYSSITHLHSIGKSVQGRNLWVL
VVGRSPKEHRIGIPEFKYVANMHGDEAVGRELLLHLIEYLVTRDGRDPEITNLINSTRIH
IMPSMNPDGFETVVKPDCFYNDGRDNSNLYDLNRNFPDAFELNEVPRQPETVAVMKWLTT
ETFVLSANLHGGALVASYPFDNGVPATGTLYSRSLTPDDDVFQYLANTYASRNPDMKRNS
CRIKTGFSNGIINGYSWYPLKGGMQDYNYIWAQCFEITLELSCCKYPRKEKLPGFWKDNK
DSLIEYIKQVHIGVKGQVFDQNQTPLSNVTVEVQDRKHICPYRTNKFGEYYLLLLPGSYV
IEVTVPGHDPHLTKVTIPPKSQNFSALKKDILLPFRGQLNHISESNPLCPRIPLYSELQG
HSAATKPSLFLFLVTLFHILFK
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggactgcgcccgcctctggctagggctgctaatgcctgcggtagctgccctggacttc
agctaccaccaccagccagagatggaagcgtttctgaagaatgttgcccaaaactacagt
tctatcactcacttacacagtatcgggaaatctgtacaaggcagaaacctgtgggttctc
gtcgtgggacgctctccaaaggaacacaggatcgggattccggaattcaagtacgtggca
aatatgcatggagatgaggctgtagggcgggaactgctgctccatttaattgaatatctt
gtaaccagagatggaagagaccctgaaatcacaaatctaatcaacagtacccggatacac
atcatgccctcaatgaacccagatggattcgaaactgttgtaaagcctgactgtttttac
aatgatggcagggataatagtaacctctatgacctgaatagaaatttccctgatgctttt
gagcttaatgaggtaccgaggcagcctgagaccgtggcagtcatgaagtggctgactaca
gagacctttgtcctctctgcaaacctccatggtggtgctctggtggccagttacccgttt
gataatggtgttccagccactggaacattatactctcggagcttaacccctgatgatgat
gtttttcaatatcttgcaaatacctatgcttcaaggaatcctgacatgaaaaggaattca
tgtagaattaaaacagggttttctaatggaattataaatggatactcctggtatccactg
aaaggtggaatgcaagattacaactacatctgggcccagtgttttgaaattacgttggag
ctgtcatgctgtaaatatcctcgcaaggagaagcttccaggcttctggaaggataacaaa
gattcgctgattgaatatataaaacaggtgcacataggtgtaaagggccaagtttttgat
cagaaccagactccattatccaatgtaactgtagaagtccaagacagaaaacatatctgc
ccctatagaaccaacaaatttggagagtattacctcctcctcttgcctggatcctatgta
atagaggttacagtccctggacatgatccacatctcacaaaggtgactattccccccaaa
tcccagaacttcagtgctcttaaaaaggatattttacttccattcagagggcaattgaat
catatctcagaatcaaatcctttatgtcccaggattcctctttacagtgaactgcaaggc
cactcagctgcaacaaaacccagtctgttcttatttttagtgactctttttcacatattg
ttcaaataa

DBGET integrated database retrieval system