KEGG   Bos taurus (cow): 513710Help
Entry
513710            CDS       T01008                                 

Gene name
CPT1C
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, brain isoform isoform X1
  KO
K19524  carnitine O-palmitoyltransferase 1, brain isoform [EC:2.3.1.21]
Organism
bta  Bos taurus (cow)
Pathway
bta00071  Fatty acid degradation
bta01212  Fatty acid metabolism
bta03320  PPAR signaling pathway
bta04152  AMPK signaling pathway
bta04714  Thermogenesis
bta04920  Adipocytokine signaling pathway
bta04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    513710 (CPT1C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    513710 (CPT1C)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    513710 (CPT1C)
   04920 Adipocytokine signaling pathway
    513710 (CPT1C)
   03320 PPAR signaling pathway
    513710 (CPT1C)
  09159 Environmental adaptation
   04714 Thermogenesis
    513710 (CPT1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bta03029]
    513710 (CPT1C)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     513710 (CPT1C)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    513710 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 513710
NCBI-ProteinID: XP_002695166
BGD-bta: BT22853
Ensembl: ENSBTAG00000012205
VGNC: 27678
Position
18
AA seq 779 aa AA seqDB search
MAEAHQAVGFRPSLTSDAGEVELGVPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLACFLQLDPSLGLMEKIKESLPDWGGQHHRLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPVLSDKDFDWTAGLAQEFLKLQASLLQWYLQLKSWWASNYVSDWWEEFV
YLRSRNSLMVNSNYYMMDFLYVTPTPVQAARAGNAVHALLLYRHRLDRQEILPTLLMGMR
PLCSAQYEKIFNTTRIPGVHRDHIRHLRDSRHVAVFHRGRFFRVGTHSQSRLLSPRALEQ
QFQRILDDPSPACPHEEHLAALTAAPRDTWAQVRRSLKTQAQEALEAVEGAAFFVSLDSE
PAGLTREDPAASLDAYAHALLAGQGHDRWFDKSFSLIVFSNGKLGLSVEHSWADCPISGH
MWEFTLATECFQLGYSADGHCKGHPDPLLPQPQRLHWDLPDKIHLSISLALRAAKTLSGN
IDCHVFPFSHFGKNFIKRCHLSSDSFIQTTLQLAHFRDRGQFCLTYESTMTRLFLEGRTE
TVRSCTREARDFVRAMEDKEKTDAQCLALFRLAVDKHQALLKAAMSGQGVDRHLFALYIV
SQFLHLQSPFLDQVHSEQWQLATSQIPVQQIHLFDVRNYPDYVSSGGGFGPADDHGYGVS
YMFMGDDVITFHISSKKSSTRTDSHRLGQRIQDALLDVAALFPEGQRLKRRGLGEEDSG
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagctcaccaggcggtgggcttccgaccctcactgacttcggacgcgggggaa
gtggagctcggtgtcccggtgttacaggagatctacctctccggactgcgctcttggaaa
aggcatctctcccgtttctggaacgactttctcacaggtgtgttccctgctagccccctc
agctggcttttcctcttcagtgcaattcaacttgcctgcttcctccagctggatccttcc
ttaggactgatggagaagatcaaagagtctctgccagactggggtggacagcatcacagg
ctgcggggggtcctggcggccgcgctgtttgcgtcctgtctgtggggagctctgatcttc
acgcttcatgtggccctgaggctacttctgtcctaccacggctggctcctcgaaccccac
ggagccatgtcctcgccaaccaagacctggctggccctggtgcgcatcttctccggccgc
catccaatgctcttcagttaccagcgctctcttccgcgtcagcctgtgccctccgttcag
gacactgtgcgcaagtatctggagtctgtccgacccgtcctctccgacaaggacttcgac
tggaccgcgggcctagcgcaggaattcctgaagctgcaggcctcactgctgcagtggtac
ttgcagctcaagtcctggtgggcgtccaattacgtcagtgactggtgggaagaattcgtg
tacctgcgctccaggaactcactgatggtgaacagcaactattacatgatggacttcctg
tacgtcacgcccactcctgtgcaggcggcgcgcgcgggcaacgcagtccacgccctcctt
ctgtaccgccaccgcctggaccgccaggagatcctgccaactttgctgatgggaatgcga
cccttgtgctctgcccagtatgagaagatattcaacaccacgcgaattcccggggtccac
agagatcacatccgccacctccgtgacagccgacacgtggctgtcttccaccggggccgg
ttcttccgcgtggggacccactcgcaaagccgcctgctttccccgcgggccctggagcag
cagtttcaacgaatcctggacgacccctctcccgcctgcccccacgaggagcatctggcg
gccttgaccgctgctccgagggacacctgggcccaggtgcggaggtctctgaagacccag
gcccaggaggccctggaagctgtcgaaggggccgctttcttcgtatccctcgactcagag
cccgcggggctcaccagggaggaccccgcagcttccttagacgcctacgcacatgccctg
ctggccggccagggccacgaccgctggtttgacaaatccttctccctaatcgtcttctcc
aatgggaagctgggcctcagcgtggagcactcatgggctgactgccccatctcaggacac
atgtgggagttcactctggccacagaatgctttcagctgggctactcggcagacggtcac
tgcaaggggcaccctgaccccttgctgccccagccccagaggctgcactgggaccttcca
gacaagatccatctatccatctctctagccctgagggcagccaagaccttgtctggaaac
atcgactgccacgtcttccccttctcccactttggcaagaatttcatcaaacgctgccat
ctctcttcagacagcttcatccagaccaccttgcagctggcccacttccgggacaggggt
cagttctgcctgacttatgaatccaccatgactcgcttgttcctggaaggccgcacagag
acggtgcgttcttgcacgagggaggcccgcgactttgtgagagccatggaggacaaagag
aagacagacgcacagtgcctcgccctgttccgcctggcggtggataagcaccaagctctg
ctgaaggcagcgatgagtggacagggggtcgatcgccacctctttgctctctacatcgtg
tcccagttcctccacctgcagtctccattcctggaccaggttcactcagagcagtggcag
ctggccaccagccagattcctgttcagcaaattcacctgttcgacgttcgtaattacccc
gactatgtctcctctggtggtggattcgggcctgccgatgaccatggttacggtgtgtcc
tacatgttcatgggcgatgacgtgatcaccttccacatctcgagcaaaaaatcaagcaca
agaacggactcccaccggctgggccagcgcatccaggacgccttgttggacgtggccgcc
ctcttcccggaggggcagcgtcttaagcgcagagggttaggggaggaagactcgggttag

DBGET integrated database retrieval system