KEGG   Bos taurus (cow): 513804Help
Entry
513804            CDS       T01008                                 

Gene name
COL17A1
Definition
(RefSeq) collagen alpha-1(XVII) chain
  KO
K07603  collagen, type XVII, alpha
Organism
bta  Bos taurus (cow)
Pathway
bta04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    513804 (COL17A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen DUF2868
Motif
Other DBs
NCBI-GeneID: 513804
NCBI-ProteinID: NP_001095450
BGD-bta: BT10482
Ensembl: ENSBTAG00000002430
VGNC: 27558
UniProt: A6QPB3
Position
26
AA seq 1473 aa AA seqDB search
MDITQKNKRDGTEVTERIITETVTTRLTSLPPKGGTSNGYAKTGSLGGGSRLEKQSLTHG
SSGYINSSGSLRGNASTSSYRRAHSPASTLPNSPGSTFERKTHVTRHGTYEGSSSGNSSP
EYPRKEFASSSTRGRSQTRESEIRVRLQSASPSTRWTELDDVKRLLKGSRSASVSPTRNS
SNTLPIPKKGTVETKVVTASSQSVSGTYDTTILDANLPSHVWSSTLPAGSSMGTYHNNIT
TQSSSLLNTNAYSAGSVFGVPNNMASCSATLQPGISTSSSVFGMQNNLAPSSSTLSHGMA
ATSTAYGVKKNMPQSPTAVSTGVSTSAASTTNVQNDDLLHKDCKFLILEKDNTPAKKEME
LLIMTKDSGKVFTASPASVAATSFSEDTLKKEKQAAYTDTYLVSEANGDVKTVTAKGNGA
SADIHGYDHRRGGGGGGGSGGALGSGAAGGGGKGSWGAAPTWCPCGSWCSWWKWLLGLLL
TWLLLLGLLFGLIALAEEVRKLKARVEELEKMRGRLSYNEKMERSSQDSVQGVAPRLGEG
LGKSELDDYNLEDVWQFMKVRLMTEQENGNLRGSPGPKGDMGVQGPKGDRGFPGTPGIPG
PLGHQGPEGPKGQKGNVGEPGMEGPMGQRGREGPMGPRGEPGPPGFGEKGDRGDAGKPGI
PGPPGVPGSVGPKGSIGPQGLRGEVGLPGIKGDKGPMGPPGPKGDQGEKGPRGLTGEPGL
KGLPGAVGEPGAKGAMGPAGPDGHQGPRGEQGLPGMPGTRGLPGPSGDPGKPGLTGPQGP
QGIPGTPGRPGVKGEPGAPGKIMTSEGSSTITVPGPPGPPGAMGPPGPPGAPGPVGPAGL
PGQQGPRGEPGLAGESFMGSSSSFSEVLSTQGIDLRGPPGPPGPPGPPGEGLPGPPGPPG
SLLTSSETFFSGPPGPPGPPGPKGDQGPPGPRGHQGERGFPGLSGSGSSSLGLNLQGPPG
PPGPQGPKGDKGDPGVPGAPGIPGGPSRGGSSSSTTFMQGPPGPPGPPGPPGSLSSSGLE
IQQYISDYMQSDSIRPYLSGVQGPPGPPGPPGPVTTITGETFNYSELASLVVSYLQTSGY
NIGTSSTSISSEDILAALRRDDVRQYLQQYLMPQGAGGDWFLQSLDYAELSNRILSYMSS
TGVSIGLPGPPGPPGLPGTSYEELLSLLQGSEFRGIVGPPGPPGPPGLPGSSWSSISTED
LSSYLQTAGLSSIPGPPGPPGPPGPRGPPGISGALATYAAENSDSFRSELISYLTSPDVR
SFIVGPPGPPGPQGPPGDTRLVSTDSSYSRSGSSSSFSRDTSYSSSMGIGGASGGSLGEA
GAFGMDMGRGYGAAAESGMYGGNGRFGTSFAGGLDYNELAVRVSESLQRQGLLQGMAYTV
QGPPGRPGPQGPPGISKIFSAYSNVTEDLMDFFRTYGAIPGPPGQKGEMGIPGPKGERGP
AGPPGPRGHKGEKGDKGDQFYIGRRRRSIAVKP
NT seq 4422 nt NT seq  +upstreamnt  +downstreamnt
atggacataacccagaagaacaaacgggatggcactgaagtcactgaaagaatcatcaca
gaaacagtaactacaagacttacatccttaccaccaaaaggggggaccagcaatggctat
gctaaaacaggatctctgggtggagggagccggctggagaaacagagcctgacgcatggc
agcagcggctacataaactcaagtgggagcttgcgaggcaatgcctccacctccagttac
aggagggcccattcacctgcctccactctgcccaactcaccaggctcaacttttgagagg
aagactcatgtcacccgccatggaacatatgaagggagctccagtggcaactcttccccc
gagtatcctcggaaggaatttgcatcttcttcaaccagaggacggagccaaacacgagag
agcgagatccgagtccgactgcagagcgcatccccatctacccgctggacagaattggat
gacgtcaagcgtttgctcaaggggagccgctcagcaagcgtgagccccacccggaattcc
tctaacacactccccatccccaagaaaggcaccgtggagaccaaggtggtgacagcaagc
tcccagtcagtgtctggcacctatgatacaaccatcctggatgccaaccttccctcccac
gtgtggtcctccacgttgccggcggggtcctccatgggcacctatcacaacaacatcaca
acccagagctcatccctgctcaacaccaatgcctattctgcaggatcagtctttggagtt
ccaaataacatggcctcctgctccgcaactctgcagcccggaatcagcaccagctcctca
gtgttcggcatgcagaacaatctggcccccagctcatccaccctgtcccatggcatggcc
gccacctccacagcatatggtgtgaagaaaaacatgccccagagccccactgctgtgagc
actggggtgtccacttctgcagccagcaccacaaatgtccagaatgatgacctcttgcac
aaggactgtaaattcctgatcctggagaaggacaacacgcccgccaagaaggagatggag
ctgctgatcatgaccaaggacagcgggaaggtctttacagcctccccagccagcgtcgct
gcaacttctttttcagaggacaccctaaaaaaggaaaaacaagctgcatacaccgacacc
tacctagtgtcagaagctaacggagatgtgaagactgtgactgcaaagggcaacggggcc
tctgcagacatccacggctacgaccaccgccgtggtggtggaggcggcggcggcagcggc
ggtgcccttggcagtggggccgctggtggagggggcaagggctcgtggggggcagcgcct
acctggtgcccctgcggctcctggtgcagctggtggaagtggctgctgggcctgctgctc
acctggctactgctcctggggctgctcttcggccttatcgctctggccgaggaggtgagg
aaactgaaggcacgtgtggaggagctggagaaaatgcggggccgcttgtcttacaacgag
aagatggagaggagcagccaggactctgtgcagggggttgcgcccaggctgggggaaggt
ttaggaaaatctgagcttgacgactacaatctggaggacgtctggcaattcatgaaggtc
aggctgatgacagaacaggaaaatggaaatctccgaggaagccctgggcctaaaggtgac
atgggagttcaaggccctaaaggagaccgcgggttccctggaactccaggtatccctggg
cccttgggccaccaaggtccggagggaccaaagggacagaaaggcaacgtgggtgagcct
ggcatggagggacccatgggccagagagggcgagaaggccccatgggacctcgcggtgaa
ccagggccccctgggtttggagagaaaggagacagaggggatgctggtaaaccgggtatt
ccgggcccacctggtgtcccaggctctgtcggtcccaaaggctctataggtccccaagga
ctccgaggtgaagtgggactccctggtatcaaaggtgacaaaggacccatgggaccaccg
gggcccaaaggtgaccagggtgagaaaggaccccgaggcctcacaggcgagcctggcttg
aaaggtttacctggtgccgtgggtgagcccggggctaaaggagcgatgggacccgctggc
cctgacggacatcaaggcccaagaggggaacaaggtcttccaggaatgccgggaacccgg
ggcttaccaggaccttctggggacccagggaagccaggtctcactggaccccaaggacct
cagggaattcctggtacccccggccgaccaggagttaaaggtgaaccaggagctccaggc
aagatcatgacttcagagggatcgtcgactatcactgtcccaggtcccccgggacctcct
ggagccatgggacctccgggacctccaggagccccaggccctgttggtccagctggtctt
ccaggacagcaaggcccgcgaggggagccgggcctggctggcgaatcattcatgggcagc
agcagctccttctctgaggtcctgtccacccagggtattgatttacgaggccccccaggc
ccacctggacctcccgggccaccaggggaaggcttgccaggcccaccaggcccaccagga
tctctcctgaccagctcagagactttcttctctggccctccaggcccacctggcccccca
ggccccaagggagaccaaggccccccaggcccccgaggacaccaaggcgagcgaggcttc
ccagggctgtcaggctcaggctccagttctcttggactcaacctgcagggaccaccaggc
ccacccggccctcagggacccaagggtgacaaaggtgatcccggagtcccaggggctcct
ggcattcctggtgggccctctcgagggggatcgtcgtcaagtaccacgttcatgcagggt
cctccaggcccaccagggccccccgggcctccaggctccctcagcagctctggcctggag
attcagcaatacatctctgactacatgcagagtgacagtatcaggccttatctgtctgga
gttcagggtcccccaggcccacctggtccccccgggcctgtcaccaccatcaccggtgag
actttcaactactcagagctggccagcctcgtcgtgagctacttacagacttccggctac
aacatcggcacatcctccacctccatctcttctgaagacatcctggctgcgctccggcga
gatgatgtgcgtcagtatctacagcagtacctgatgccgcaaggagccggtggagattgg
ttcctccagtctctggattatgcagagctgagcaaccgcatcctcagctacatgtccagc
actggagtcagcatcgggcttcctggccccccggggcccccaggcttgccgggcacatcc
tatgaggagctcctctccttgctccaagggtctgaattcagaggtatcgttgggccccca
ggtccccctgggcccccagggctcccaggcagttcatggtccagcatcagcacggaggat
ctctcatcctacctgcagactgccggcttatcatccatcccaggccctcctggtcccccg
ggtcccccaggccctagagggcccccgggcatctcaggagctctggcgacatacgcagct
gaaaacagtgacagcttccggagtgagctgattagctatctcacaagtcctgatgtgcgt
agcttcatcgttggccccccgggtccccctgggccccaggggccccccggggacacccgc
ctggtgtccacggacagctcctacagccggagtggcagctcctcctctttcagtagggac
acctcctacagctcctccatgggcataggaggagccagtggaggctccctgggcgaagcg
ggagcctttggcatggacatgggccgaggctacggggccgcagccgagagtggcatgtat
ggcggcaatggcagattcgggaccagctttgccggaggtctggattacaacgagctggct
gttcgggtgtcggagagcttgcagcgtcaggggctgctccaagggatggcctacacggtg
cagggccccccaggccggcctgggccccaggggccccctggcatcagcaagatcttctcc
gcctacagcaatgtgactgaggacctcatggactttttccgaacttatggagccatccca
ggaccccctgggcagaagggagagatgggcatccctggacccaaaggtgagaggggccct
gctgggccaccaggtcctcgagggcacaagggagaaaaaggagacaaaggtgaccaattc
tacattgggcggaggaggagaagcattgccgtcaagccataa

DBGET integrated database retrieval system