KEGG   Bos taurus (cow): 513959Help
Entry
513959            CDS       T01008                                 

Gene name
PHF8
Definition
(RefSeq) histone lysine demethylase PHF8 isoform X1
  KO
K19415  lysine-specific demethylase PHF8 [EC:1.14.11.27]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    513959 (PHF8)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.27  [histone-H3]-lysine-36 demethylase
     513959 (PHF8)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    513959 (PHF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JHD JmjC Cupin_8 PHD PHD_2 PHD_4
Motif
Other DBs
NCBI-GeneID: 513959
NCBI-ProteinID: XP_002700168
BGD-bta: BT15568
Ensembl: ENSBTAG00000013289
VGNC: 32828
Position
X
AA seq 1024 aa AA seqDB search
MASVPVYCLCRLPYDVTRFMIECDMCQDWFHGSCVGVEEEKAADIDLYHCPNCEVLHGPS
IMKKRRVSSKGHDTHKGKPVKTGSPTFIRELRSRTFDSSDEVILKPTGSQLTVEFLEENS
FSVPILVLKKDGLGMTLPSPSFTVRDVEHYVGSDKEIDVIDVARQADCKMKLGDFVKYYY
SGKREKVLNVISLEFSDTRLSNLVETPKIVRKLSWVENLWPEECIFERPNVQKYCLMSVR
DSYTDFHIDFGGTSVWYHVLKGEKIFYLIRPTNANLTLFECWSSSSNQNEMFFGDQVDKC
YKCSVKQGQTLFIPTGWIHAVLTPVDCLAFGGNFLHSLNIEMQLKAYEIEKRLSTADLFK
FPNFETICWYVGKHILDIFRGLRENRRHPASYLVHGGKALNLAFRAWTKKEALPDHEDEI
PETVRTVQLIKDLAREIRLVEDIFQQNVGKTSNIFGLQRIFPAGSIPLTRPAHSTSVSMS
RLSLPSKSGSKKKGLKPKEFFKKAERKGKESSALGPAGQLSYNLMDTYNHQALKTGSSQK
AKFNITGTCLNDSDDDSPDLDLDGNEGPLALLMSNGSTKKVKSLSKSRRAKIVKKADKTR
VVSEQVMEDELDLDSDDELQIDERLGKEKATLLIRPKFPRKLPRAKPCSDPNRVREPGEV
EFDIEEDYTTDEDLIEGVEGKLGNGSGAGGILDLLKASRQVGGPDYAALTEAPASPSTQE
AIQGMLCMANLQSSSSSPATSSLQAWWTGGQDRSSTSSNSGLGTMSSSPASQRTPGKRPI
KRPAYWKTESEEEEENASLDEQDSLGACFKDAEYIYPSLESDDDDPALKSRHKKKKNSDD
APWSPKARVTPTLPKQDRPVREGTRVASIETGLAAAAAKLAQQELQKAQKKKYIKKKPLL
KEVEQPRPQEPNLSMAVPAPTLAATPQLLTSSSPLPPPEPKQEALSGSLADHEYTARPNA
FGMAQANRSTTPMAPGVFLTQRRPSVGSQSNQAGQGKRPKKGLATAKQRLGRILKIHRNG
KLLL
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagtaccagtgtattgcctctgtcggctgccttatgatgtgacccgcttcatg
atcgagtgtgacatgtgccaggactggtttcatggcagttgtgttggtgtcgaagaggag
aaggctgctgacattgacctctaccactgccccaactgtgaggtcttacatgggccctcc
attatgaaaaaacgccgtgtatcttcaaaaggccatgatacacacaaggggaagccagtg
aagacgggaagccctacattcattcgagagctccggagtaggacctttgacagttcagat
gaagtgattctgaagcccactggaagtcagttgaccgtggaattcctggaagagaatagc
ttcagtgtgcccatcctggtcttgaagaaagatggattggggatgacgttgccctcacca
tcattcactgtgagggatgtggaacactatgttggttctgacaaagagattgatgtgatt
gatgtggcccgccaggccgactgcaagatgaagcttggtgattttgtgaaatattattat
agcgggaagagggagaaagtcctcaatgttattagtttggaattctctgataccaggctt
tctaaccttgtggagacacccaagattgttcggaagctctcatgggtggagaacttgtgg
ccagaggagtgtatctttgagaggcccaacgtgcagaagtactgcctcatgagcgtgcgg
gatagctatacagactttcacattgactttggtggcacctcggtctggtaccatgtgctc
aagggtgagaagatcttctacctgatccgtccaacaaatgccaacctgactctctttgag
tgctggagcagttcctctaaccagaatgagatgttctttggggaccaggtggacaagtgc
tacaagtgttctgtgaagcaaggacagacacttttcattcctacaggatggattcatgct
gtgctgacccccgtggactgccttgcctttggagggaatttcttacacagccttaatatt
gaaatgcagctcaaagcctatgagattgagaaacggttgagcacagcagacctcttcaag
ttccccaactttgagaccatctgttggtatgtgggaaagcacatcctggacatctttcga
ggtttgcgagaaaacaggagacaccctgcctcctacctggtccatggtggtaaagctctg
aacttggcctttagagcctggacaaagaaagaagctctgccagaccacgaggatgaaatc
ccagagacagtgcggactgttcagctcattaaagatctggctagggagatccgcctggtg
gaagatatcttccaacagaacgttgggaagacgagcaatatctttgggctgcagaggatc
ttcccagccggctccattcccttaaccaggccagcccattccacttcagtatccatgtcc
aggctgtcactgccctccaaaagtggttcaaagaagaaaggcctgaagcccaaggaattc
ttcaagaaggcagagcgaaagggcaaggagagctcagccttggggcctgctggccaattg
agctataatctcatggatacatacaatcatcaggcactgaagacaggctcttcccagaaa
gcaaagttcaacatcactggcacctgcttgaatgactcagatgatgactcgccagacttg
gaccttgatgggaatgagggcccgctggccctattgatgtctaatggcagtaccaagaag
gtgaagagcttatctaagtctcggcgagccaagatcgtgaagaaggcagacaagactagg
gtggtgtcagaacaggtgatggaggatgaattggacttggattcagatgatgaactgcag
attgatgagagactgggaaaggagaaggcgaccctgttaataagaccaaaatttccccga
aagctgcctcgtgcgaagccttgctcggaccccaatcgagttcgtgaaccaggagaagtt
gagtttgacattgaggaggactatacaacagatgaggaccttatagaaggggtcgaaggc
aagcttggaaatgggagtggagccggtggaattcttgatctgctcaaggccagcaggcag
gtggggggacctgactatgctgccctcactgaggctcctgcctctcccagcactcaggag
gctatccagggcatgctgtgcatggccaacctgcagtcctcatcatcctcaccagctacc
tccagcctgcaggcctggtggaccggagggcaggaccgaagcagcacgagttccaacagt
gggctgggcacaatgtctagcagtcctgcttcccagcgcaccccagggaagcggcccatc
aagcggccagcctactggaaaaccgaaagcgaggaggaagaggagaacgccagtcttgat
gaacaggacagcttgggagcatgcttcaaggatgcagagtatatttacccttccctggag
tctgatgatgatgaccctgctttgaaatctcgacacaagaaaaagaagaattcagatgat
gctccatggagtcctaaagcccgtgtgaccccaactttaccgaagcaggaccgtcctgtg
cgtgaggggacccgggtagcttccattgagacaggcttggctgcagcagctgcaaagttg
gcccagcaggagctacagaaggcccaaaaaaagaaatatatcaagaagaagcctttgttg
aaggaggtagaacagcctcgccctcaagagcccaatctcagcatggcagtaccagcccca
actctggctgctacaccccagcttctcacctcctcatcacccctgcctcctcctgagcct
aaacaagaagcgctctcaggaagtcttgctgaccatgagtatactgctcgtcccaatgcc
tttggcatggcccaagcaaatcgcagtaccacacccatggccccaggtgtcttcctgacc
cagcggcgcccttcagttggctcccagagcaatcaagcaggacaaggaaagcgtcccaaa
aagggcctggctacagcaaagcagagactcggccgtatcctgaaaatccacagaaatggc
aaactgcttctgtga

DBGET integrated database retrieval system