KEGG   Bos taurus (cow): 514128Help
Entry
514128            CDS       T01008                                 

Gene name
BYSL
Definition
(RefSeq) bystin
  KO
K14797  essential nuclear protein 1
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bta03009]
    514128 (BYSL)
Ribosome biogenesis [BR:bta03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    514128 (BYSL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bystin Beta-lactamase
Motif
Other DBs
NCBI-GeneID: 514128
NCBI-ProteinID: NP_001014924
BGD-bta: BT23186
Ensembl: ENSBTAG00000010101
VGNC: 26611
UniProt: Q5E9N0
Position
23
AA seq 435 aa AA seqDB search
MPKFKAARGAGVQEKHAPLAEQILAGDAVRAGTREKRRGRGTGDEEEEYVGPRLTRRILQ
QARQQQEELEAEHGSGDRPAVPRERTTRLGPGVPQDGSDDEEWPTLEQAAARAGPGYQAE
VVVDPEDERAIEMFMNQNPPARRTLADIIMEKLTEKQTEVETVMSEVSGFPVPQLDPRVL
EVYRGVREVLSKYRSGKLPKAFKIIPALSNWEQILYITEPEAWTAAAMYQATRIFASNLK
ERMAQRFYNLVLLPRVRDDIAEYKRLNFHLYMALKKALFKPGAWFKGILIPLCESGTCTL
REAIIVGSIITKCSIPVLHSSAAMLKIAEMEYSGANSIFLRLLLDKKYALPYRVLDALVF
HFLGFRTEKRELPVLWHQCLLTLVQRYKADLATEQKEALLELLRLQPHPQLSPEIRRELQ
SAVPRDVEDVPVTME
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagttcaaggcggcccgcggggccggggttcaggaaaagcatgcgccgctggcc
gagcagatcctggctggggacgcggtgcgggcaggaacccgagaaaaacggcggggtcgc
ggaaccggagacgaggaggaagagtacgtggggccccggttgacccgacggattttgcag
caagcgcggcagcagcaagaggagctcgaggccgagcatgggagcggggacaggcccgca
gtgccgcgggagcgcactacgcggcttggtccaggcgtgccgcaggatgggtcagatgac
gaggagtggcccaccctggagcaggctgccgcaagggcagggccgggctatcaggcggag
gtggtcgtggaccccgaggatgagcgtgccattgagatgttcatgaaccagaaccctcct
gccaggcgcaccctggctgacatcatcatggagaagttaactgagaagcagacggaagtc
gaaacagtcatgtccgaggtctcaggcttccctgtgccccagctggacccccgcgtccta
gaggtctacagaggggttcgggaggtgttgtctaagtaccgcagtgggaaactgcccaag
gcatttaagatcatccctgccctctccaactgggagcagatcctctacatcacagagcct
gaggcctggaccgctgctgccatgtaccaagccacaaggatttttgcctctaacctaaag
gaacggatggcccagcgcttctataacctggttctgctcccccgggtacgagatgacatt
gctgagtacaaacgactcaacttccacctctacatggccctgaagaaggccctgttcaag
cctggagcctggtttaaaggcatcctgatcccgctgtgcgagtcgggcacctgtaccctc
cgggaagccatcatcgtgggcagcatcatcaccaagtgctccatccccgtgctgcactcc
agtgcggccatgctgaaaattgcagaaatggagtacagcggggccaacagcatcttcctg
cggctgctgctggacaagaagtacgcgctgccctaccgagtgctggacgccctggtcttc
cacttcctgggcttccggacagagaagcgtgagctgcccgtgctctggcaccagtgcctg
ttgactttggtccagcgctacaaggccgacctggccacggagcagaaggaggccctcctg
gaactgctccggctgcagccccacccccagctgtccccggagatcaggcgtgagttgcag
agtgccgtcccccgagatgtagaagatgttcccgtcaccatggagtga

DBGET integrated database retrieval system