KEGG   Bos taurus (cow): 514494
Entry
514494            CDS       T01008                                 

Gene name
CA5B
Definition
(RefSeq) carbonic anhydrase 5B, mitochondrial
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00910  Nitrogen metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    514494 (CA5B)
Enzymes [BR:bta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     514494 (CA5B)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 514494
NCBI-ProteinID: NP_001074377
BGD-bta: BT11924
Ensembl: ENSBTAG00000020418
VGNC: 26655
UniProt: F1N5D1
Position
X
AA seq 317 aa
MVMMSHLRAILQASPYKTLWRRFQIPRSMPARPCSLYTCTYKSRNRVLHPLWEKVDLAPA
GERQSPINIRWKDSVYDPGLQPLTISYDPTTCLHVWNNGYSFLVEFEDSADKSVIEGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNAVKFEHFEDAALEENGLAVI
GVFLKLGKHHKELQKLVNILPSIKHKDTLAEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFHHDY
VLNIQAKPKPSTSQVTP
NT seq 954 nt   +upstreamnt  +downstreamnt
atggtgatgatgagtcacctgagggccattcttcaagcctctccatacaagacactgtgg
agaaggttccagattccgaggtccatgcctgcaaggccttgcagcctctacacctgcact
tacaaatcccggaaccgagtcttgcacccgctctgggagaaagtggacctggccccggcg
ggtgagcgccagtcgcccatcaacatccggtggaaggacagtgtctacgatcctggctta
caaccgctcaccatctcttatgacccgaccacctgcctccacgtctggaataacgggtac
tctttcctcgtggaatttgaagattctgcagataaatcagtgatcgagggaggacccctg
gaacacaactaccgattaaagcagttccattttcactggggggccattgatgcctggggc
tctgagcataccgtggacagcaaatgttacccggcagagctgcatttggtgcattggaat
gcagtcaagtttgaacactttgaggatgcagcactggaagaaaatggtttggctgtgata
ggagtatttttaaagctaggcaagcatcacaaagagctacagaaactggtgaatattttg
ccatcaattaagcacaaggacacacttgcagaatttgggtcattcgacccttcctgtctg
atgcctacttgcccagattactggacctactcggggtccctgactacaccgccactctct
gagtctgtcacttggatcattaagaagcagcctgtagaggttgatcatgatcagcttgag
caatttcgaaccctgctcttcacttccgagggggagaaagagaaaagaatggtggacaac
ttccgcccccttcagcccctaatgaaccgcactgtccgctcatccttccatcatgactat
gtgctgaacatacaagcaaaacccaagccttccaccagccaagtgactccctaa

DBGET integrated database retrieval system