KEGG   Bos taurus (cow): 514526Help
Entry
514526            CDS       T01008                                 

Gene name
KLHL40
Definition
(RefSeq) kelch-like protein 40
  KO
K10473  kelch repeat and BTB domain-containing protein 5/10
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bta04121]
    514526 (KLHL40)
Ubiquitin system [BR:bta04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     514526 (KLHL40)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kelch_1 BTB BACK Kelch_6 Kelch_4 Kelch_3 Trypsin Kelch_2 Kelch_5 DUF316
Motif
Other DBs
NCBI-GeneID: 514526
NCBI-ProteinID: NP_001015598
BGD-bta: BT27824
Ensembl: ENSBTAG00000006563
VGNC: 30665
UniProt: Q58DJ7
Position
22
AA seq 664 aa AA seqDB search
MALGLEQAEEQRLYQQTLLQDGLKDMLDHGKFLDCVVRVGEREFPCHRLVLAACSPYFRA
RFLAEPESAGELRLEEVSPDVVAQVLHYLYTSEIALDEASVQDLFAAAHRFQIPSIFTIC
VSFLQKRLCLANCLAVFRLGLLLDCARLAVSARDFICARFSLVARDADFLGLSADELIAI
ISSDGLNVEKEEAVFEAVMRWASSGDAEAQAERQRALPTVFESVRFRLLPRAFLESRVER
HPLVRAQPELLRKVQMVKDAHEGRITVLRKKKKEKGKESAGAKATDKGTTEAKAEEEEEE
AERILPGILNDTLRFGMFLQDLIFMISEEGAVAYDPAANECYCASLSTQIPKNHVSLVTK
ENQIFVAGGLFYNEDNKEDPMSAYFLQFDHLDSEWLGMPPLPSPRCLFGLGEALNSIYVV
GGRELKDDEQSLDSVMCYDRLSFKWGESDPLPYAVYGHSVLSHMDLVYVIGGKGSNRKCL
NKMSVYDPKKFEWRELAPMKTPRSLFGATIHDGRIFVAAGVTDTGLTSSAEVYSIADNKW
APFEAFPQERSSLSLVSLAGTLYAIGGFATLETESGELVPTELNDIWRYNEDEKKWEGVL
REIASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQT
LAAN
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgggcttggagcaagcggaggagcagcggctgtaccagcagacgctcctgcag
gacgggctcaaggacatgctggaccacggcaagttcctcgactgtgtggtgcgggtgggc
gagcgcgagttcccgtgccaccgcctggtactggccgcctgcagcccctacttccgggcg
cgcttcctggccgaacctgagagcgcaggcgagctgcgcctggaggaggtgtcccctgac
gtggtggcccaggtgctccactatctgtacacgtcagagatcgcgctggacgaggcgagc
gtgcaggacctgttcgccgcggcgcaccgcttccagatcccttccatcttcaccatctgc
gtgtccttcttgcagaagcgcctgtgcctggccaactgcctggcggtcttccgcctcggc
ctcctgctcgactgcgcgcgcctcgcggtgtccgcccgcgacttcatctgcgcgcgcttc
tcgctggtggcccgcgacgccgacttcctagggctctcggccgacgagctcattgctatc
atctccagcgatggcctcaacgtggagaaggaggaagccgtgttcgaagcggtgatgcga
tgggcaagcagcggtgacgccgaggcgcaagccgagcgccagcgcgcactgcccacggtc
ttcgagagcgtgcgcttccgcttgctgccacgcgccttcctagagagccgcgtggagcgc
caccctctcgtgcgtgcccagccggagctgctgcgcaaggtgcagatggtgaaagatgcc
cacgagggccgcatcactgtgctgcgcaagaagaagaaggagaaggggaaggagtcggct
ggggccaaggccactgacaagggcacaaccgaagccaaggcggaggaggaggaagaggag
gcagagcgcattctacccgggatcctcaatgacaccctgcgctttggcatgttcctgcag
gacctcatcttcatgatcagtgaggagggcgccgtggcctatgacccggcagccaacgag
tgctactgtgcctccctctcgacccagatccccaagaaccatgtcagcctagtgaccaaa
gagaaccagatcttcgtggctggaggccttttctacaatgaggacaacaaagaggacccc
atgagcgcttacttcttgcagtttgaccacctggactcagagtggctggggatgccgccg
ctgccctcgccgcgctgcctcttcggcttgggagaggctcttaactccatctacgtggtt
ggcggcagagagctcaaggacgacgagcaaagcctggactcggtcatgtgctacgacaga
ctgtcgttcaaatggggcgaatcggacccgctgccctatgccgtgtacggacactcggtg
ctctcccatatggacctggtctacgtcattggcgggaagggcagcaacaggaagtgcctg
aacaagatgtcggtctacgaccctaaaaagttcgagtggagggagctggcgcccatgaag
actccccgctcactcttcggggccaccatccatgacggccgcatttttgtagctgctggg
gtcacagacacagggctgaccagctcagccgaggtgtacagcattgcagacaacaagtgg
gcaccctttgaggccttcccacaggagcgcagctcactcagcctggtcagcctggcgggc
accctctatgccatcggtggctttgccactctggagactgagtccggggagctggttccc
acagagctcaacgacatctggagatacaatgaggacgagaagaagtgggagggggtcctc
cgggagatcgccagcggtgtctcctcttgcatgggcgactctggcggccccctggtctgc
aagaagaatggagcctggaccctggtgggcatcgtgtcctggggcagcagcacgtgctcc
acgtccacccctggcgtgtacgcccgcgtcactgctctcgtcaactgggtgcagcagacc
ctggccgccaactga

DBGET integrated database retrieval system