KEGG   Bos taurus (cow): 514580Help
Entry
514580            CDS       T01008                                 

Gene name
TRIM11
Definition
(RefSeq) E3 ubiquitin-protein ligase TRIM11
  KO
K10650  tripartite motif-containing protein 11 [EC:2.3.2.27]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bta04121]
    514580 (TRIM11)
Enzymes [BR:bta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     514580 (TRIM11)
Ubiquitin system [BR:bta04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    514580 (TRIM11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRY zf-C3HC4_4 SPRY zf-C3HC4 zf-RING_UBOX zf-C3HC4_2 zf-C3HC4_3 zf-B_box zf-RING_2 zf-RING_5 zf-RING_6 Prok-RING_4 U-box zf-RING_11 zf-Nse zf-RING_10 zf-ANAPC11
Motif
Other DBs
NCBI-GeneID: 514580
NCBI-ProteinID: NP_001071388
BGD-bta: BT24409
Ensembl: ENSBTAG00000039246
VGNC: 36313
UniProt: A0JN74
Position
7
AA seq 468 aa AA seqDB search
MAAPDLSTNLQEEATCAICLDYFTDPVMTDCGHNFCRECIRRCWGQPEGPYACPECRELF
PQRNLRPNRPLAKMAEMARRLHPPSPVPQGVCAAHREPLAAFCGDELRLLCAACERSGEH
WAHRVRPLQDAAEDLKSKLEKSLEHLRKQMEDALLFQAQAEETCSLWQKMVETQRQNVLT
EFERLRRLLVEEEQLLLQRLEEEELEVLPPLRESAARLGQQSAQLAELITELEGRCQLPA
LGLLQDIRDTLRRVQDVKLQPPEVVPMEMRTVCRVPGLVEALRRFRGDMTLDPDTANPEL
VLSEDRRSVRRGDLRQALPDSPERFDPGPCVLGREPLTSGRHYWEVEVGERASWALGVCR
ENANRKEKGELFAGNGFWILVFLGSYYNSSERAFAPLRDPPRRVGIFLDYEAGHLSFYSA
NDGSLLYTFPETPFSGTLRALFSPLSSSPTPMTICRLKGGPGDGLAPQ
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggccgcacccgacctgtcgaccaacctccaagaggaggccacctgcgccatctgcctc
gactacttcacggatccagtgatgaccgactgcggccacaacttctgccgcgagtgcatc
cggcgctgctggggccagcccgagggcccgtacgcctgccccgagtgccgcgagctgttc
cctcagaggaacctgcgacccaaccgcccgctcgccaagatggccgagatggcgcggcgc
ctgcacccaccgtcgcctgttccgcagggagtgtgcgcagcgcaccgcgagccgctggcc
gccttctgcggcgacgagctgcgccttctgtgcgcggcctgcgagcgttcaggggagcac
tgggcgcaccgtgtgcgcccgctgcaggacgcggccgaagaccttaagagcaagctggag
aaatccctggagcatctgcggaagcaaatggaggatgcgctgctgttccaggcccaagcg
gaggagacctgctccctgtggcagaagatggtagagacccagcggcagaatgtactgacc
gagtttgagaggctgcgccgtctgctcgtggaggaggagcagctgctgctgcagaggctg
gaagaggaggagctggaggtgctgccccccttgagggagagtgcggcccgccttggacag
cagagcgcccagctggccgagctgatcaccgagctggagggccgctgccagctgcctgca
ctggggctgctgcaggacatcagggacacactccgcagagtccaggacgtgaagctgcag
cctcccgaggtggtgcctatggagatgaggaccgtgtgcagggtccctgggctggtggag
gccttgcggaggttccgaggggacatgaccctggatcctgacacagccaaccctgagttg
gtgctgtccgaggaccggaggagcgtgcggcgtggggacctgcggcaggccctgcccgac
agcccggagcggttcgaccctgggccttgtgtgctgggccgggagcccctgacctcgggc
cgccactactgggaggtggaggtgggggagcgggccagctgggccctgggtgtctgcaga
gagaacgccaaccgcaaggagaagggcgagctgtttgctggcaacggcttctggatcctg
gtgttcctgggaagctactacaactcctccgagcgagcttttgcccctctccgagaccca
ccccggcgcgtgggcatctttctggactacgaggctggacacctgtccttctacagtgcc
aatgatgggtcgctcttgtatacctttcctgagacgcccttctcggggaccctgcgggcc
ctcttctctcctctgtctagcagcccgacccctatgaccatctgcaggctgaaaggcggg
cccggggatgggctggctccccagtga

DBGET integrated database retrieval system