KEGG   Bos taurus (cow): 514617
Entry
514617            CDS       T01008                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 precursor
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bta01002]
    514617 (ERAP1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     514617 (ERAP1)
Peptidases and inhibitors [BR:bta01002]
 Metallo peptidases
  Family M1
   514617 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N DUF1570
Other DBs
NCBI-GeneID: 514617
NCBI-ProteinID: NP_001095473
BGD-bta: BT15452
Ensembl: ENSBTAG00000013557
VGNC: 28560
UniProt: A7MB81
Position
7
AA seq 942 aa
MISPSIKWSLGTRPLLLSTLLILLTVATPSSCQSREPTSPKASNGAPFPWNKIRLPEHII
PAHYDLMIHANLTTLTFGGTTQIEITASKPTSTIILHSHRLQISKAALRKGGGERQAEEP
LRVLENPPQEQIALLASEPLVVGLPYTIVIDYAGNLSESFHGFYKSTYRTKEGEVRILVS
TQFEPTAARMAFPCFDEPAFKASFLIKIRRGPRHLAISNMPLVKSVTVAEGLIEDHFDVT
VRMSTYLVAFIVSDFKSVSKMTKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSI
PYPLPKQDLAAIPDFQSGAMENWGLTTYRESSLLFDAEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVEDYFFGKCFNAMEVDALNSSHPV
STPVENPAQIREMFDEVSYDKGACILNMLRDYLGADAFKSGIVKYLQKYSYKNTKNEDLW
NSMASICPTDDTQRMDGFCSRGEHASSTAHWRQEGLDVKTMMNTWTLQKGFPLITITVRG
RNVHMKQEYYVKGAADAPETGFLWHVPLTFITSKSDAVQRFLLKTRTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTGLLKGTHTAISSNDRASLINNAFQLVSIGKLSIEKALD
LTLYLKHETEIMPVFQGLNELIPMYKLMEKREMNEVETQFKAFLIRLLRDLIDKQTWTDE
GSVSERMLRSQLLFLACVRKYQPCVQKAEGYFRQWQEAGGNLSLPNDVTLAVFAVGAQTL
EGWDFLYSKYQSSLSSTEKNQIEFALCISQNKEKLQWLLDQSFKGDVIKTQEFPDILRAI
GRNPVGYPLAWQFLRENWNKLVQKFELGSNSIAYMVTGTTDQFSTRARLEEVKEFFSSLK
ENGSQLRCVQQTIETIEENIRWMDKNFDKIRTWLQNEKLNLL
NT seq 2829 nt   +upstreamnt  +downstreamnt
atgatatctccatccatcaaatggtcacttggaaccaggcccttactgctttcgacactg
ctgattctcttaacggtggcaactccatcctcatgtcagagcagggaaccaacatctcca
aaagctagcaacggggcaccatttccttggaataaaattcgacttccagagcacatcatc
ccagctcattacgatctcatgattcacgcaaacctcaccactctgactttcgggggaacc
acacagatagaaatcacagccagcaagcccaccagtaccatcatcctgcacagtcaccgc
ctacaaatatccaaggccgccctgaggaagggaggtggcgagaggcaggctgaagagcca
ctgagagtcctggaaaacccacctcaggagcagattgcgcttctggcttctgagccgctg
gtcgtcggcctcccatacaccattgtcatcgactacgctggcaatctttctgagagtttc
catggattttataaaagtacctacagaaccaaggaaggagaagtgaggatacttgtatca
acacagttcgaaccaactgcagccagaatggcctttccctgctttgatgaacctgctttc
aaggcgagttttttaatcaagatcagaaggggaccaagacacctcgccatctccaatatg
ccactggttaaatctgtgactgtggctgaaggactcatagaagaccactttgacgtcacc
gtgaggatgagcacctacctggtggccttcattgtttcggatttcaagtctgtcagcaag
atgaccaagagcggagtcaaggtttccgtatatgctgttccagacaagataaatcaggca
gattatgcactggatgccgcggtgactcttctagaattttatgaggattatttcagcatc
ccgtatccgttacccaaacaagatcttgctgcgattcctgacttccagtctggtgcaatg
gaaaactggggactgacgacatacagggaatcttctctactgtttgatgctgagaagtct
tccgcctcaagtaagctcggcatcacaatgactgtgtctcatgaactcgcccaccagtgg
tttgggaacctcgtcactatggaatggtggaatgatctttggctaaatgagggatttgcc
aagtttatggagttcgtgtcagtcagtgtgactcatccagaactgaaagttgaagattat
ttctttggtaagtgtttcaacgcaatggaggtggatgcattaaactcctcacaccccgtg
tccacacccgtggagaaccctgctcagattcgggagatgtttgatgaagtttcttatgac
aagggagcttgtattctgaatatgctaagggactatcttggtgccgatgcatttaaaagt
ggcattgtaaagtatctgcagaagtatagctataaaaacacgaaaaacgaggacctgtgg
aatagtatggcaagcatctgccctacagatgacacacaacgcatggatggattttgttct
agaggtgaacatgcatcttcaaccgcgcactggcgacaggaaggccttgatgtgaaaacc
atgatgaacacctggacgctgcagaagggtttccccctgataaccatcaccgtgagaggc
aggaacgtacatatgaagcaagagtactatgtgaaaggcgcggccgatgccccagaaact
gggttcctgtggcatgtcccactgacattcattaccagcaaatcagacgcagtccaacgc
tttttgctgaagacaagaacagatgtgctcatcctcccagaagaggtggaatggatcaaa
tttaatgtcggaatgaatggctattacattgtgcattatgaggatgatggatgggactct
ctgactggccttttaaaaggaacacacacggcaatcagcagtaacgatcgggccagtctc
attaacaatgcatttcagcttgtcagcattggaaagctgtcaattgaaaaagccttggat
ttaaccttgtacctgaagcatgaaactgaaatcatgccagtgtttcaaggtttgaatgag
ctgataccgatgtataagttaatggagaagagagagatgaatgaagtggaaactcaattc
aaggcctttctcatcaggctgctgagggacctcattgacaagcagacgtggacggatgag
ggctccgtctcggagcgaatgctgcggagtcagctgctcttcctcgcctgcgtgcgcaag
taccagccctgcgtgcagaaggcagaaggctatttcagacagtggcaggaagccggtgga
aacctcagcctgcccaacgatgtgaccttggcagtgtttgccgtgggggcccagaccctc
gaaggatgggattttctttatagtaaataccagtcgtcattgtccagtactgagaaaaac
caaattgaatttgctctctgtatcagccaaaataaagaaaagcttcagtggctactagat
caaagttttaagggagatgtaataaaaactcaagagtttccagatattcttagagctatt
ggcagaaacccagtgggatatccgttggcctggcagtttctgagggaaaactggaacaaa
cttgtgcaaaagtttgaacttggctcaaattccatagcctacatggtaacgggaacaaca
gatcagttctcaacaagagcacggctcgaagaggtaaaagaattcttcagctctttgaag
gaaaacgggtctcagctccgttgtgttcaacaaaccatcgaaactatcgaggaaaacata
cgttggatggataagaattttgataagatcagaacgtggctgcaaaatgagaagcttaat
ctgctataa

DBGET integrated database retrieval system