KEGG   Bos taurus (cow): 514933
Entry
514933            CDS       T01008                                 

Gene name
EBI3
Definition
(RefSeq) interleukin-27 subunit beta precursor
  KO
K24476  interleukin 27 subunit beta
Organism
bta  Bos taurus (cow)
Pathway
bta04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    514933 (EBI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bta04052]
    514933 (EBI3)
Cytokines and growth factors [BR:bta04052]
 Cytokines
  Interleukins
   514933 (EBI3)
SSDB
Motif
Pfam: fn3 Interfer-bind
Other DBs
NCBI-GeneID: 514933
NCBI-ProteinID: NP_001093835
BGD-bta: BT29142
Ensembl: ENSBTAG00000012829
UniProt: A6QPV0
Position
7
AA seq 232 aa
MALRLVLAFAVSLWLGCSFCREREGHPVASSQPRVRCQASRYPVAVDCSWTLPPTPPNST
RPTSFIATYRLGVAAHGESWPCLQQTPEATSCVIPDVQMFSMVPYVLNITAVHPGGVSSS
FVPFVPEHIIKPDPPEGVCLSPLPGQRLWVQWEPPRTWPFPEIFSLKYRIRYKRHGAARF
RQVGPIEATSFTLKAVRPQAKYCIQVAAQDLTDYGEWSAWSLPAAASMTLGK
NT seq 699 nt   +upstreamnt  +downstreamnt
atggccctgagactcgtcctggcttttgccgtcagcctctggctgggctgctcattctgt
cgagagagagaaggccacccagtagcttcctcccagcccagggtgcggtgccaggcctcc
aggtacccggtcgccgtggactgctcctggaccctgccgcccactcctccgaactccacc
aggccgacatcattcattgccacctacaggcttggcgtggcagctcatggggaaagctgg
ccctgcctccagcagacaccggaagccaccagctgtgtcatccccgacgtccagatgttc
tccatggtgccctatgtgctcaacatcacagctgtccaccccggcggtgtcagcagcagc
ttcgtgccctttgtcccagagcacatcatcaaaccggatcctccagaaggcgtgtgcctg
agccccctccctgggcagcggctgtgggtgcaatgggagcccccccggacctggcccttc
ccagagatcttctccctcaagtaccggatccgctacaagcgtcatggggctgctcgcttc
cgtcaggtggggccaattgaagccacatccttcaccctcaaggctgtgaggcctcaagcc
aagtactgcatccaagtggccgctcaggacctcaccgactacggggaatggagtgcctgg
agtctccctgctgctgcctccatgaccctgggcaagtag

DBGET integrated database retrieval system