KEGG   Bos taurus (cow): 515187
Entry
515187            CDS       T01008                                 

Gene name
CTNND1
Definition
(RefSeq) catenin delta-1
  KO
K05690  catenin (cadherin-associated protein), delta 1
Organism
bta  Bos taurus (cow)
Pathway
bta04015  Rap1 signaling pathway
bta04520  Adherens junction
bta04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    515187 (CTNND1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    515187 (CTNND1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    515187 (CTNND1)
SSDB
Motif
Pfam: Arm Cnd1 Ebp2 HYPK_UBA
Other DBs
NCBI-GeneID: 515187
NCBI-ProteinID: NP_001179331
BGD-bta: BT22014
Ensembl: ENSBTAG00000002411
VGNC: 27805
Position
15
AA seq 960 aa
MDDSEVESPASILASVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDASPLLANGTL
TRRHQNGRFVGDADLERQKFSDLSLNGPQDHSHLLYSTVPRMQEPGQIVETYTEEDPEGA
MSVVSVETSDDGTTRRTETTVKKVVKTVTTRTVQPVPMGPDGLPVDASAVSNSYIQTLGR
DFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGSGDNYGSLSRVTRIEER
YRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFHPEPYGLEDDQRSMGYDDVDYGMMS
DYGTGRRTGTPSDPRRRLRSYEDMIGEEVPSDQYYWAPLAQHERGSLASLDSLRKGGPPP
PNWRQPELPEVIAMLGFRLDAVKSNAAAYLQHLCYRNDKVKTDVRKLKGVPVLVGLLDHP
KKEVHLGACGALKNISFGRDQENKIAIKNCDGVPALVRLLRKARDMDLTEVITGTLWNLS
SHDSIKMEIVDHALHALTDEVIIPHSGWEREPSEDCKPRHVEWESVLTNTAGCLRNVSSE
RSEARRKLRECDGLVDALIFIVQAEIGQKDSDSKLVENCVCLLRNLSYQVHREIPQAERY
QEAPPSVANSTGPHAASCFGAKKGKGKKPTEDPTNDTVDFPKRTSPARGYELLFQPEVIR
IYISLLKESKNPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERV
VKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQSSSQNFSEDTVVSILNTINEVI
AENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKK
SDFQVSLNNASRSQSSHSYDDSTLPLIDRSQRSDKKPDREEIQMSSMGSNTKSLDNNYST
LNERGDHNRTLDRPGDLGEMEPLKGAPLMQDEGQESLEEELDVLFLDEGEPMSCPAMQKI
NT seq 2883 nt   +upstreamnt  +downstreamnt
atggacgactcggaggtggagtcgcccgccagcatcctggcctccgtgaaggagcaggag
gcgcaatttgagaagctgacccgggcgctggaggaggagcggcgccacgtctcggcgcag
ctggagcgcgtccgcgtctccccgcaggacgccagcccgctcctggccaacggcacgctc
acccgccggcaccagaacggccgctttgtgggcgatgctgaccttgagcgacagaaattt
tcagatctaagcctcaacggaccccaggatcacagccaccttctgtacagcactgtcccc
aggatgcaggagccggggcagattgtggagacctacacggaagaggaccccgagggtgcc
atgtctgtggtctccgtggagacctcggacgacggaaccactcggcgcacagagaccaca
gtcaagaaagtggtgaagacggtgacgacgcggacggtgcagccagtccctatggggccc
gacgggctgcctgtagacgcctcggcggtgtcgaacagctacatccagactctggggcgt
gacttccgcaagaacggcaacgggggccctggtccctacgtggggcaagcaggcacggcc
accctccccaggaacttccactaccctcccgacggatacagccgccactacgaggacggg
tatcccgggagcggcgacaactacggcagcctgtcgcgggtgacccgcatcgaggagcgg
taccggcccagcatggaaggttaccgggcgcccagccggcaggacgtctacgggccgcag
ccccaggtccgggtgggcgggagcagtgtggacctgcaccgcttccatccggagccctac
gggctggaggatgaccagcgaagcatgggctacgatgacgtggattacggcatgatgtcc
gattacggcacgggccggcggacggggacgccctctgacccgcggcggcgcctcaggagc
tatgaagacatgattggtgaggaggtgccatcagaccagtactactgggcgcctctggcc
cagcacgaacgagggagtctggcaagcttggacagcctgcgcaagggcgggcccccgccc
cccaactggagacagccggagctgcccgaggtgatcgccatgctggggttccgcctggac
gccgtcaagtccaacgcggctgcgtacctgcagcacttgtgctaccgcaacgacaaggtg
aagacggacgtccggaagctcaagggcgtcccagtgctggtgggattgttagaccacccc
aaaaaggaggtgcaccttggcgcctgtggcgctctcaagaatatctcttttgggcgtgac
caggagaacaagatcgctataaaaaactgtgacggtgttcctgctctcgtgcgattgctc
cgaaaggcccgtgacatggacctcactgaagtgattactggaaccctgtggaatctctca
tcccatgactccataaaaatggagatcgtggaccacgcgctgcatgccttaacggatgaa
gtgatcattccccattcggggtgggagcgggaacctagcgaagactgtaagccacgccac
gtcgagtgggagtccgtgctcaccaataccgccggctgcctcaggaatgtcagctcggag
aggagtgaagcacgccggaaacttcgggagtgcgatgggttggtggatgctctcattttc
attgtccaggctgagattggacagaaagattcggatagcaagcttgtcgagaactgcgtc
tgcctccttcggaacctgtcctatcaagttcaccgggagatcccgcaagcagagcgctac
caggaggcgcctcccagcgtcgccaacagtaccgggccgcatgctgccagctgctttggg
gccaagaaaggcaaagggaaaaaacccacagaggatccaacaaacgatacagtggacttc
cctaaaagaactagtcctgctcgaggttatgagcttttatttcagccggaggtgattcgg
atatacatctcactcctcaaagagagcaagaatcccgccatcctagaagcgtcagctggg
gccatccagaacttgtgtgctgggcgctggacgtatggtcgatacatccgctcagctctg
cgtcaagagaaagctctttccgccattgctgacctcctgaccaatgaacacgagcgggtt
gtgaaagctgcatctggagccctgagaaacctggctgtggatgcgcgcaacaaagagttg
attggtaaacatgccattcctaacttggtcaagaatctgccaggagggcagcagagctct
tcgcagaatttctctgaggacactgtggtctctattctgaacaccatcaacgaagttatc
gctgagaacttggaggctgccaaaaagctccgggagacccagggtattgagaagctggtt
ttgatcaacaaatcagggaaccgctcagaaaaagaagttcgagcagccgcgcttgtgtta
cagacgatctgggggtataaggagctgcggaagccactggagaaggaaggctggaagaag
tcagactttcaggtgagcctgaacaatgcttctcggagccagagcagccactcctatgat
gacagcacgctccctctcattgaccggagccagagatcagataagaaacctgatcgggaa
gaaattcagatgagcagtatgggatcaaatacgaaatcgttagataacaactattccaca
ctcaatgaaagaggggaccacaacagaacactggaccgacccggagacctaggcgaaatg
gagccactgaagggagcacccctgatgcaggacgaggggcaggagtctctggaggaggag
ttggatgtgttgtttttggatgagggggagcccatgtcttgccctgccatgcagaagatt
tag

DBGET integrated database retrieval system