KEGG   Bos taurus (cow): 515363
Entry
515363            CDS       T01008                                 
Symbol
PHB2
Name
(RefSeq) prohibitin-2
  KO
K17081  prohibitin 2
Organism
bta  Bos taurus (cow)
Pathway
bta04137  Mitophagy - animal
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    515363 (PHB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bta03029]
    515363 (PHB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    515363 (PHB2)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Mitochondrial movement
    515363 (PHB2)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   515363 (PHB2)
SSDB
Motif
Pfam: Band_7 Med2
Other DBs
NCBI-GeneID: 515363
NCBI-ProteinID: NP_001039663
BGD-bta: BT27987
Ensembl: ENSBTAG00000013123
VGNC: 32809
UniProt: Q2HJ97
Position
5:103493075..103497686
AA seq 299 aa
MAQNLKDLAGRLPSGPRGMGTALKLLLGAGAVAYGIRESVFTVEGGHRAIFFNRIGGVQQ
DTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAMELPSM
YQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILD
DVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAARMLGE
ALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK
NT seq 900 nt   +upstreamnt  +downstreamnt
atggcccagaacttgaaggacttagccggacggctgccctccgggccccggggcatgggc
acggcgctgaagctactgctgggggccggcgccgtggcctacggcatccgcgaatccgtg
ttcaccgtggaaggagggcacagagccattttctttaatcggatcggaggggtgcagcag
gacaccattctggccgagggccttcacttcaggatcccctggttccagtaccccatcatc
tatgacattcgggccagaccccgaaaaatttcctcccccacaggctccaaagacctgcaa
atggtgaacatctccctgcgggtgctgtcccgacccaatgccatggagctgcccagcatg
taccagcgcctggggctggactacgaggagcgagtgctgccgtccattgtcaacgaggtg
ctcaagagcgtggtggccaagttcaacgcctcccagctgatcactcaacgggcccaggtg
tccttgctaatccgacgggagctgaccgagagggccaaggacttcagcctcatcttggac
gacgtagccatcaccgagctgagcttcagccgcgagtacacggccgctgtggaagccaaa
caagtggcccagcaggaggcccagcgcgcccagttcctggtggagaaggcaaagcaggaa
cagcggcagaagatcgtgcaggcggagggtgaggccgaggcggcgcggatgttgggagag
gccctgagcaagaacccaggttatatcaagctacgcaagatccgggcagcccagaacatc
tccaagacgattgccacctcacagaatcgtatctatctcactgctgacaacctcgtgctc
aacctacaggatgaaagtttcacccggggaagtgacagcctcatcaagggtaagaaatga

DBGET integrated database retrieval system