KEGG   Bos taurus (cow): 515614
Entry
515614            CDS       T01008                                 

Gene name
HMBS
Definition
(RefSeq) porphobilinogen deaminase
  KO
K01749  hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
bta  Bos taurus (cow)
Pathway
bta00860  Porphyrin and chlorophyll metabolism
bta01100  Metabolic pathways
bta01240  Biosynthesis of cofactors
Module
bta_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    515614 (HMBS)
Enzymes [BR:bta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     515614 (HMBS)
SSDB
Motif
Pfam: Porphobil_deam Porphobil_deamC MGS
Other DBs
NCBI-GeneID: 515614
NCBI-ProteinID: NP_001039672
BGD-bta: BT17531
Ensembl: ENSBTAG00000005364
VGNC: 29870
UniProt: Q2KIN5
Position
15
AA seq 361 aa
MSGNGNAAAIAEEDTPKMRVIRVGTRKSQLARIQTDSVVATLKALYPGLQFEIIAMSTTG
DKILDTALSKIGEKSLFTKELEHALERNEVDLVVHSLKDLPTVLPPGFTIGAVCKRESPY
DAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFKSIRGNLNTRLRKLDEL
QEFSAIILATAGLQRMGWQNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHD
PETLLRCIAERSFLRHLEGGCSVPVAVHTAIKDGQLYLTGGVWSLNGAETMQDTMQTTIH
VPVQHEDGPEDDPQLVGITARNIPRQPQLAAENLGISLATLLLNKGAKNILDVARQLNEA
H
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtctggtaatggcaacgcggccgcaatagcggaagaagacaccccaaagatgagagtg
attcgagtgggtacccgcaagagccagctggctcgcatacagacggacagtgtggtggca
acgctgaaagctttatacccaggcctgcagtttgaaataattgctatgtccaccacgggg
gacaagattcttgataccgcgctctctaagattggagagaagagcctgtttaccaaggag
ctggagcatgctttggagaggaatgaagtggacctagttgttcattcgctgaaggacctg
cccacggtgcttcctcctggcttcaccattggagctgtctgcaagcgggagagcccctat
gatgctgttgtctttcacccaaaatttgttgggaagactctagaaaccttgccagagaag
agtgtggtaggaactagctccctgcggagagcagcccagctgcagagaaagttcccacat
ctggagttcaagagtattcggggaaacctcaacacgcgactgcggaagctggatgagctg
caggagttcagtgccatcatcctggccacagctggcctgcagcgcatgggctggcagaac
cgggtggggcagatcctgcaccccgaggagtgcatgtatgctgtgggtcagggggctctg
ggtgtggaagttcgagccaaagaccaggacatcttggatctggtgggtgtgttgcacgat
cctgagactctacttcgctgcattgctgaacgatccttcctaaggcacctggaaggaggt
tgcagtgtgccagtggcagtgcatacagctattaaggatgggcaactgtacctgactgga
ggagtctggagtctgaatggtgcagagaccatgcaagacaccatgcaaaccaccatccat
gtccctgtccagcatgaagatggccctgaagatgatccacagctggtgggcatcactgcc
cggaacattccacgacaaccccagctggctgctgagaacctgggcatcagcctggccacc
ttgttgctgaacaaaggagccaagaacatcttggatgttgcacggcagctcaatgaagcc
cactaa

DBGET integrated database retrieval system