KEGG   Bos taurus (cow): 515669Help
Entry
515669            CDS       T01008                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
bta  Bos taurus (cow)
Pathway
bta00562  Inositol phosphate metabolism
bta01100  Metabolic pathways
bta04015  Rap1 signaling pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04062  Chemokine signaling pathway
bta04070  Phosphatidylinositol signaling system
bta04071  Sphingolipid signaling pathway
bta04072  Phospholipase D signaling pathway
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04310  Wnt signaling pathway
bta04371  Apelin signaling pathway
bta04540  Gap junction
bta04611  Platelet activation
bta04621  NOD-like receptor signaling pathway
bta04713  Circadian entrainment
bta04720  Long-term potentiation
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04725  Cholinergic synapse
bta04726  Serotonergic synapse
bta04728  Dopaminergic synapse
bta04730  Long-term depression
bta04750  Inflammatory mediator regulation of TRP channels
bta04911  Insulin secretion
bta04912  GnRH signaling pathway
bta04915  Estrogen signaling pathway
bta04916  Melanogenesis
bta04918  Thyroid hormone synthesis
bta04919  Thyroid hormone signaling pathway
bta04921  Oxytocin signaling pathway
bta04922  Glucagon signaling pathway
bta04924  Renin secretion
bta04925  Aldosterone synthesis and secretion
bta04926  Relaxin signaling pathway
bta04927  Cortisol synthesis and secretion
bta04928  Parathyroid hormone synthesis, secretion and action
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta04934  Cushing's syndrome
bta04961  Endocrine and other factor-regulated calcium reabsorption
bta04970  Salivary secretion
bta04971  Gastric acid secretion
bta04972  Pancreatic secretion
bta05010  Alzheimer's disease
bta05016  Huntington's disease
bta05142  Chagas disease (American trypanosomiasis)
bta05143  African trypanosomiasis
bta05146  Amoebiasis
bta05200  Pathways in cancer
Module
bta_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    515669 (PLCB3)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    515669 (PLCB3)
   04310 Wnt signaling pathway
    515669 (PLCB3)
   04371 Apelin signaling pathway
    515669 (PLCB3)
   04020 Calcium signaling pathway
    515669 (PLCB3)
   04070 Phosphatidylinositol signaling system
    515669 (PLCB3)
   04072 Phospholipase D signaling pathway
    515669 (PLCB3)
   04071 Sphingolipid signaling pathway
    515669 (PLCB3)
   04022 cGMP - PKG signaling pathway
    515669 (PLCB3)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    515669 (PLCB3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    515669 (PLCB3)
   04621 NOD-like receptor signaling pathway
    515669 (PLCB3)
   04062 Chemokine signaling pathway
    515669 (PLCB3)
  Endocrine system
   04911 Insulin secretion
    515669 (PLCB3)
   04922 Glucagon signaling pathway
    515669 (PLCB3)
   04912 GnRH signaling pathway
    515669 (PLCB3)
   04915 Estrogen signaling pathway
    515669 (PLCB3)
   04921 Oxytocin signaling pathway
    515669 (PLCB3)
   04926 Relaxin signaling pathway
    515669 (PLCB3)
   04918 Thyroid hormone synthesis
    515669 (PLCB3)
   04919 Thyroid hormone signaling pathway
    515669 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    515669 (PLCB3)
   04916 Melanogenesis
    515669 (PLCB3)
   04924 Renin secretion
    515669 (PLCB3)
   04925 Aldosterone synthesis and secretion
    515669 (PLCB3)
   04927 Cortisol synthesis and secretion
    515669 (PLCB3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    515669 (PLCB3)
   04270 Vascular smooth muscle contraction
    515669 (PLCB3)
  Digestive system
   04970 Salivary secretion
    515669 (PLCB3)
   04971 Gastric acid secretion
    515669 (PLCB3)
   04972 Pancreatic secretion
    515669 (PLCB3)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    515669 (PLCB3)
  Nervous system
   04724 Glutamatergic synapse
    515669 (PLCB3)
   04725 Cholinergic synapse
    515669 (PLCB3)
   04728 Dopaminergic synapse
    515669 (PLCB3)
   04726 Serotonergic synapse
    515669 (PLCB3)
   04720 Long-term potentiation
    515669 (PLCB3)
   04730 Long-term depression
    515669 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    515669 (PLCB3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    515669 (PLCB3)
  Environmental adaptation
   04713 Circadian entrainment
    515669 (PLCB3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    515669 (PLCB3)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    515669 (PLCB3)
   05016 Huntington's disease
    515669 (PLCB3)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    515669 (PLCB3)
   04934 Cushing's syndrome
    515669 (PLCB3)
  Infectious diseases
   05146 Amoebiasis
    515669 (PLCB3)
   05142 Chagas disease (American trypanosomiasis)
    515669 (PLCB3)
   05143 African trypanosomiasis
    515669 (PLCB3)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     515669 (PLCB3)
Membrane trafficking [BR:bta04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    515669 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    515669 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y EF-hand_like C2
Motif
Other DBs
NCBI-GeneID: 515669
NCBI-ProteinID: NP_001179352
Ensembl: ENSBTAG00000012510
VGNC: 32982
UniProt: E1BHX7
Position
29
AA seq 1234 aa AA seqDB search
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDSNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRLGSGVPDS
SVRKRPLEQSNSALSESSATTEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPRKSLGE
EGLQRGPDVLGPAYREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANAVRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQSGPETSQETQTQQL
GCQLNPHPTPSPLDASPRRPPGPATSPTSSSISSSISSPGQRDDLIASILSEVAPAPLDE
LRGHKALVKLRSRQERDFRELYKKHQRKAVALTRRLLDNLAQARAGSRCRQRPGVLSGED
ERAEEEEVSRYQEFQKKQVQCLLELREAQVDTEADRRLEHLQQAQLKLREVVLDAHMTQL
KKLKEINEREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRQERLVAGQQQILQQLAEEEPKLLAQLVQDCQEQRERLPQEIRWSLLGETQEGLG
DGHLVACASNGHAPGSSGHLPGADSESQEETTKL
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccaggcccggcgtccacgcgctgcagctagagccgcccaccgtcgtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagtcggaacctg
gtaaccctgcgagtggactccaatggcttcttcctgtactggacgggacccaacatggag
gtggacacactcgacatcagttccatcagggataccaggacgggccgttatgcccgcctg
cccaaggaccccaagatccgggaggtgttgggctttgggggccctgatgcccggttggag
gagaagctgatgacagtggtggccgggccagacccagtgaatacaacattcttgaacttc
atggccgtgcaggatgatacagccaaggtctggtccgaggagctcttcaagttggctatg
aacatcctggctcagaacgcctcccggaacaccttcttgcgcaaagcatacacgaagctg
aagctgcaggtaaaccaggatggacggattccagtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtagaaactgcactggaatcctgtggcctcaatttcaaccgaagc
gagtccatccggcctgacgagttttccttggaaatctttgagcggttcctgaacaagctg
tgtctgcggccagacattgataagatcctgctggagataggtgccaagggcaaaccttac
ctgacgctggagcagctcatggatttcattaaccagaagcagcgggacccgcggctcaac
gaagtgctgtacccacctctgcggccctcccaggcccgactgctcatcgagaagtacgaa
cccaacaagcagttcctggagcgagaccagatgtccatggagggcttcagccgctacctg
ggaggtgaggagaatggcattctgccgcttgaggccttggatctgagcacagacatgacc
cagccgctcagcgcctacttcatcaattcctcgcacaacacctatctcacggcggggcag
ctggccggaacctcgtcggtggagatgtaccggcaggcgctgttgtggggctgccgctgt
gtggagctggacgtgtggaaggggcggccgcccgaggaggagccgttcatcacgcacggc
ttcaccatgaccacggaggtgccgctgagagacgtgcttgaggccatcgcggagacggcc
ttcaagacttcgccctaccccgtcatcctctcctttgagaaccacgtggactcggcgaaa
cagcaggccaagatggctgagtactgccgctccatctttggggatgctctgctcatcgac
cccctggacaagtacccgctggccccaggcgtccccctgcccagcccccaggacctgatg
ggccgcatcctggtgaagaacaagaagcggcaccgactcggcagcggcgtccccgacagc
tccgtgcgcaagcggccactggagcagagcaactcggccctgagcgagagctccgccacc
accgagccctcctcgccccagctcgggtcccccagctctgacagctgcccaggcctgagc
aatggggaggaggtgggcctcgagaagcccagcctggagcctcggaagtctctgggggag
gagggtttgcagcggggccctgatgttcttggacctgcctaccgggaggatgaggaagag
gacgaggaagaggaggaacaaacggaccccaaaaagccgaccacggatgagggcactgcc
agcagtgaggtcaacgccactgaggaaatgtccacactcgtcaactatatcgagcctgtc
aagttcaagtccttcgaggctgctcgaaagaggaacaagtgcttcgagatgtcgtccttc
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgcgtggactcgtccaactacatg
ccccagctcttctggaacgtgggctgccagctcgttgcactcaactttcagaccctggat
gtgccaatgcagctcaacgccggcgtgtttgagtacaacgggcgcagcggctacctactc
aagcctgagttcatgcggcggccggacaagtcctttgaccccttcaccgaagtcatagtg
gacggcatcgtggccaatgccgtgcgggtcaaggtgatctcggggcagttcctgtccgac
aggaaggtgggaatctacgtggaggtagacatgttcgggcttcctgttgacacgcggcgc
aagtaccgcacacggacctcacaggggaactcgttcaaccctgtgtgggatgaggagcca
ttcgacttccccaaggtggtgctgcccacactggcttcgctgcgcatcgcggcctttgag
gaggggggcaagttcgtggggcaccggatcctgcctgtctctgctatccgctcagggtac
cattacatctgcctgcggaatgaggccaaccagccgctgtgcctgccagccctgctcatc
tacaccgaggcctccgactacatccccgacgaccaccaggactatgcagaggccctgatc
aaccccatcaagcatgtcagcctgatggaccagagggccaagcagctggctgccctcatt
ggggagagcgaggctcagtctggcccggagacgagccaggagacccagactcagcagctg
gggtgccagctgaacccacacccgacgcccagcccgctggacgcctccccgcgccggccc
ccaggccccgccacctccccgaccagctcctccatcagctcctccatcagcagcccaggt
cagcgcgatgatcttatcgccagcatcctctcagaggtggccccggccccgctggacgag
ctccgaggccacaaggccctagtgaagctccggagccggcaagagcgagacttccgggag
ctgtacaagaaacatcagcggaaggccgttgccctcacgcgccggttgctcgacaacctg
gcccaggcccgtgcggggagcaggtgccgacagcggcctggtgtcctaagcggggaggac
gagagggcagaagaggaagaggttagcaggtatcaagagttccagaagaaacaggtgcag
tgtctgctggagctgagggaggcccaggtggacacagaggcggatcggaggctggagcac
ctgcagcaggctcagctgaagctcagggaggttgtcctggacgctcacatgactcagttg
aagaaactgaaggagataaacgagagggagaagaaggagctgcagaagatcctggacagg
aaacgccacaacagcatctcagaggccaagaccagggagaaacataagaaagaggcggaa
ctgacagagattaaccgtcggcacatcactgagtcagtcaactccatccgtcggctggag
gaggcccagaagcagcggcaggaacgccttgtggccggacagcagcagatcctccaacag
ctggcggaagaggagcccaagctgctggcccagctggtccaggactgtcaggagcagcgg
gagaggctgccccaggagatccgctggagcctgctgggcgagacacaggagggactgggg
gacgggcatctggtcgcctgtgccagcaacggtcacgcgcctgggagcagcgggcacctg
cccggcgctgactcagagagccaggaggagactacaaagctctga

DBGET integrated database retrieval system