KEGG   Bos taurus (cow): 515772Help
Entry
515772            CDS       T01008                                 

Gene name
OR2A5
Definition
(RefSeq) olfactory receptor 2A5
  KO
K04257  olfactory receptor
Organism
bta  Bos taurus (cow)
Pathway
bta04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    515772 (OR2A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    515772 (OR2A5)
G protein-coupled receptors [BR:bta04030]
 Others
  Chemoreception
   Olfactory
    515772 (OR2A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 515772
NCBI-ProteinID: XP_002687173
BGD-bta: BT21453
Ensembl: ENSBTAG00000007400
UniProt: E1BLF2
Position
4
AA seq 310 aa AA seqDB search
MTENQTWVTEFILLGFPLSPSMQMLLFGLFSLFYVLTLMGNGVILGLISLDPRLHTPMYF
FLSHLAIVDISYASNNVPKMLVNLLNKKNTISFVPCIMQTFLYMAFAHTECLILVVMSHD
RYVAICHPLRYSVIMSWRVCTVQAVASWTCGSLLALVHVGLILRLPFCGPHEINHFFCEI
LSVLKLACADTKLNQVVIFAASVFILVGPLCLVLGSYARILAAILRIQSAEGRRKAFSTC
SSHLCVVGLFFGSAIVMYMAPKSRHPEEQQKILSLFYSLFNPMLNPLIYSLRNKEVKGAF
RRVLWKDRLM
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaatcagacatgggtcacagaattcattctcctgggatttccgctcagccca
agcatgcagatgctcctctttgggctcttctctctgttctatgtcctcaccctgatgggg
aatggggtcatcctggggcttatctcactggaccccagactgcacacccccatgtacttc
ttcctctcacacctggccatcgtcgatatttcatatgcatcaaacaatgtcccgaagatg
ctggtgaaccttctgaacaagaaaaatactatctcctttgtcccatgcataatgcagacc
tttttgtacatggcttttgcacacactgagtgtctcatcttggtggtgatgtcccatgat
cggtacgtggccatctgccaccctcttcgttactctgtcatcatgagctggagagtgtgc
actgttcaagctgttgcttcctggacatgtggctccctcctggccctggtccatgtgggt
ctcatcctaaggctgcccttctgtgggcctcatgaaatcaaccacttcttctgtgaaatc
ctgtctgtcctcaagctggcctgtgctgacactaagctcaaccaagttgtcatttttgct
gcttctgtgtttatcttagtcgggcccctctgcctggtgctgggctcctatgcacgcatc
ctggccgccatcctgaggatccagtccgctgagggccgcaggaaggccttctccacctgc
tcctcccacctctgcgtggtcgggctcttctttggcagtgccatcgtcatgtacatggcc
cccaagtctcgccaccctgaggagcagcagaagatcctttccctgttttacagtcttttc
aaccccatgctgaacccgctgatctacagcctgaggaacaaagaggtcaaaggtgccttt
aggagagtgttgtggaaggacaggctaatgtga

DBGET integrated database retrieval system