KEGG   Bos taurus (cow): 515784Help
Entry
515784            CDS       T01008                                 

Gene name
CKAP4
Definition
(RefSeq) cytoskeleton-associated protein 4
  KO
K13999  cytoskeleton-associated protein 4
Organism
bta  Bos taurus (cow)
Pathway
bta04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    515784 (CKAP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin-6_N EzrA Prominin DUF713 Spc7 Baculo_PEP_C TMPIT DUF812 ADIP DUF3584 COG2 Fez1 DUF4200 WD40_alt COMP DUF724 Laminin_II Desmo_N DUF211 WEMBL SesA DUF3450 OmpH
Motif
Other DBs
NCBI-GeneID: 515784
NCBI-ProteinID: XP_002687704
BGD-bta: BT29661
Ensembl: ENSBTAG00000011913
VGNC: 27382
UniProt: F1ME65
Position
5
AA seq 589 aa AA seqDB search
MPSAKQRGSKGGHGAASPSEKGAHPSGGADDVAKKPPPAPQQHPPPPAPHPQQQHPPQHP
QNQAHGKGGHRGGKSSSSAAAAAASSSASCSRRLGRVLNFLFYLALVAAAAFSGWCVHHV
LEEVQHVRRSHQDFSRQREELGQGLQGVEQKVQSLQATFGTFESLVRSSQHKHDLTEKAV
KQGESEINRISEVLQKLQNEILKDLSDGIHVVKDARERDFTSLENTVEERLTELTKSIND
NIAIFTDVQKRSQKEINDVKAKVASLEDSEGYKQDLKALKEVVKEIQTSVKSKEKDMEAL
RSTIQTMESDVYTEVKELVSLKQEQQRFKEAADSEHHTLQALTEKILRAEESAAHLPEEI
RRLEEELGQLKAAALRPEEDGAFRPSEAFETLQKESQGLDSRLQSVEDGVQAARAASARQ
GESLEALRAQSEEQARRLAELQERVAGLGPDADAEGGLAGTVRGLGEAQLSLAGDVDELK
RRVAELPGAVEALQKVQEQVHTLLGREATAVPPQDLLDRLSSLDNLRASVGQVESDLKML
RTAVDSLVAYSVKIETNENNLESAKGLLEDLRNDLDRLFVKVEKIHEKV
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgccctcggccaaacaaaggggctccaagggcggccacggcgccgcgagcccctcggag
aagggcgcccacccgtcgggcggcgcggatgacgtggcgaagaagccgccgccggcgccg
cagcagcacccgccgccgcccgcgccgcacccgcagcagcagcacccgccgcagcatccg
cagaaccaggcgcacggcaagggcggccaccgcggcggcaagtcttcctcctccgccgcc
gctgctgccgcctcgtcctccgcgtcctgctcgcgtaggctcggccgggtgcttaacttt
ctcttctacctcgccctggtggcggcggccgccttctcgggctggtgtgtccaccacgtc
ctggaggaggtccagcacgtccggcgcagccaccaggacttctcccggcagcgggaggag
ctgggtcagggcttgcagggcgtcgagcagaaggtgcagtctctgcaagccacatttggt
acttttgagtccctcgtgagaagctcccagcataaacatgatctcacagagaaagctgtg
aagcagggggagagcgagatcaaccgcatcagtgaagttctacaaaaactccagaatgag
atcctcaaagacctctctgatgggatccacgtggtcaaggatgcccgggagcgagacttc
acctccctggagaacacagtggaggaaaggctgacggagctcaccaagtccatcaatgac
aacatcgccatcttcacggatgtccagaagaggagccagaaggaaatcaacgacgtgaag
gccaaggtcgcctctctggaagactcggagggatacaagcaggatctgaaagccttgaag
gaagtggttaaggaaatacaaacctctgtgaagtccaaagagaaggacatggaggccctg
agaagcaccatccagaccatggagtcggatgtctacacagaggtcaaagaactggtgagc
ctcaaacaggagcagcagaggttcaaggaggcggccgattcggaacatcacacccttcag
gcgctcacggagaagatcctccgggctgaggagtctgccgcccatctccccgaggagatc
aggagactcgaggaggagctcggccagctcaaggccgcagccctccggccagaagaagac
ggggccttcagaccctccgaggcctttgaaacgctccaaaaggagagccaaggcttggac
tcgcggctgcagagcgtggaagacggggtgcaggcggcgcgggcagcctcagcgcgccag
ggcgagagcctggaggcgctgcgcgctcagagcgaagaacaggcgcggcgcctggcggag
ctgcaggagcgcgtggccggcctgggccccgacgctgatgccgagggcggcctggcaggc
acggtgcgtggccttggcgaggcccagctctcactggccggtgacgtggacgagctgaag
cgccgcgtggccgagctccccggcgctgtggaggctctgcagaaggtgcaggagcaggtc
cacacgctgctgggccgcgaggccaccgccgtgcccccccaggacctgctggacagactc
tcctctctcgacaacctcagagcctctgtgggccaggtggagtcggacttaaaaatgctt
aggactgctgtggacagtttggtcgcgtactcggtgaagatcgagaccaacgagaacaac
ttggagtccgccaagggtttgctagaggacctgaggaatgacctggataggttgtttgtg
aaagtggaaaagattcatgagaaagtctaa

DBGET integrated database retrieval system