KEGG   Bos taurus (cow): 515845Help
Entry
515845            CDS       T01008                                 

Gene name
FANCD2
Definition
(RefSeq) Fanconi anemia group D2 protein
  KO
K10891  fanconi anemia group D2 protein
Organism
bta  Bos taurus (cow)
Pathway
bta03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    515845 (FANCD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bta03400]
    515845 (FANCD2)
DNA repair and recombination proteins [BR:bta03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     515845 (FANCD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2 UCH
Motif
Other DBs
NCBI-GeneID: 515845
NCBI-ProteinID: NP_001179358
BGD-bta: BT19730
Ensembl: ENSBTAG00000010077
VGNC: 28855
UniProt: E1BE83
Position
22
AA seq 1445 aa AA seqDB search
MISKRKLSVSENKESLTEDASEARKQPLSKKTKKSHVHNEVEENDNVFVKFLKASGITLK
TGESQNQLAVDQIVFQKKLFQTLRKHPSYPTIIEEFVSGLESYIEDQDSFRNCLLSCERV
QDEETSTGTSYCKSLIKLLLGIDTLQPAIIKVLFEKLPEFLFEKVNSDGISMPRLIINQL
KWLDRVVDSKDLTTKIMQLISVAPLCLQHDFVISLPEILGDSQHADVGKELSDLLTENTL
LTVPILDVLSSLQLESKLLTKVRQLVMGKLSSVSLDDLPVIIKFILHSVTPTDALEVISE
LREKLDLQHCILPSQFQVSLSRLRNKGQTSFSGNQENSSQDCVTLLFDVIKSAIRYEKII
SEAWIKAIERTPSEAEHKIFDLAMLLIIYSTNTQTKKYIERVLRNKIRSGCFEEDLLQGT
FYIHYLVLKDICPSILSLAQSLLNSLDQSIILFGSLLYRYSFMFFDTYCQQEVIGALVTH
VCSGNEVEVDAALDVLLELVVVSPSAMRLNAVFVKGILDYLDNMSPQQIRKLFCVLSTLA
FSKEHEANSHIQDDMHLVIRKQLSSTVFKYKLIGIIGAVTMAGVMAADRSRSSNLTPGSG
ELSSEQCTQVTSLLQLVHSCSEQSPQASGLYYDEFANLIHGRRLAPEVLEWLGQTIFNDF
QDAFVLDACDVPEGDYPFPVKALYGLEDYDSCDGIVINLLPLLFSQDFVKDGSTRTSQES
DQKLVSPLCLAPYFRLLRLCVDRQHNGNLEEIDGLLDCPIFLTDLEPGERLQSMSVKERS
FLCSLIFLTLNWFREVVNAFCRQKLPEMKGKVLTRLKHIVELQQLLEKHLAVTPDYVPPL
ANFDLETLEETPHTSTAVSAKIRMKGKTGKKRKADGGKTSSPDVLSKDDNSECDPTLAER
SQQEKEFRGKEEKTSVSLQNYHAFFREMDIEVFSILRCGLVTKFILDTEMHTEAAEVVQL
QPPELLFLLEDLTQKLDNMLTPVARRVPFLKSKGNRNIGFSHLHQRSASEIAFRVVQLLN
PMCNHLENIHNYFQCLTAENHGVVDGPGIKGQEYHTMSSCYLRLLQIFHGLFAWSGFCQL
QNNNLLYSALGILTSRLKPGERDQSMEELLRQSFHYLQNFHASIPSFQCALYLLRLLMVI
LEKSAAPAENKRQIASLAKQFLCRVWPSGEKERSSIPNDQLQALLGIYLEHTDSVLKAIE
EIAGVGVPELINSPKEASSSTFPTLTWTTFVIFFRVMMAELEKTVKGLQAGTAADSQQIH
EEKLLYWNMAVRDFSILINLIKVFDSRPVLFACLKYGRLFVEAFLKQCMPLLDFSFRKHR
EDVLSLLETFQLSTRLLHHLCGHSKIHQDTKLTKHVPLLKKTLELLVCRVKAMLILNNCR
EAFWLGNLKNRDLQGEEIISQNSQESTANESEGDTSFQGAEGGEEDKASDGEKERESDED
ESDDD
NT seq 4338 nt NT seq  +upstreamnt  +downstreamnt
atgatttccaaaagaaaactatcagtgtcagagaataaagagagcctgacagaagatgcc
tctgaagccaggaagcaaccactttccaaaaagacaaagaaatctcatgttcacaatgaa
gttgaagaaaatgacaatgtctttgtaaagtttcttaaggcatcaggaattactcttaaa
accggagagagtcagaaccaactagctgtggatcaaatcgttttccaaaagaaactcttt
cagactctgaggaaacatccttcttatcccacaataatagaagagttcgttagtggcctg
gagtcttacattgaggaccaggacagtttcaggaactgccttttgtcttgtgaacgtgtg
caggatgaggaaaccagcacgggcacatcttactgtaagagcctcattaaattgcttctg
gggattgacacattacagcctgccattatcaaagtcttatttgaaaagttgccagaattt
ctttttgaaaaagtgaacagtgatggaatcagcatgcctcgactcatcatcaatcagcta
aagtggctggaccgagttgtggatagtaaggatcttaccaccaagatcatgcagctgatc
agtgttgctccgctgtgcctacaacatgactttgtcatcagcctacctgagatcctaggg
gattcccagcatgctgatgtggggaaagagctcagcgaccttctaacagagaatactctg
ctcaccgtcccgatcctggatgtcctttctagcctccaacttgagtcaaagctcctgact
aaggtccgccagttagtgatgggtaagctgtcatctgtcagtttggacgacttacctgtg
atcatcaaattcattcttcattccgtaacccccacagatgcacttgaggtaatttctgag
cttcgagagaagttggatctgcagcattgtattttgccttcacagttccaggtttctcta
agcaggttgagaaataaaggacaaacaagtttttcaggaaatcaagaaaatagcagtcaa
gactgtgttactcttctcttcgatgtaataaagtcagctattagatatgagaaaatcatt
tcagaagcctggattaaggcaattgaaaggaccccctcggaggctgaacacaagattttt
gacctggcaatgcttctcatcatctatagcaccaacactcagacaaagaagtacattgag
agggtgctaagaaataagattcgatcaggctgctttgaagaagatctgctacagggtaca
ttctatattcattacttggttcttaaggatatttgtccatccattttgtcgctggctcag
agtttgttgaactccctagaccagagcataattttgtttggcagtcttctatacagatat
tcatttatgttttttgacacttactgccagcaggaagtgatcggtgccctagtgacccat
gtctgcagtggaaatgaagtcgaagttgatgctgcattggatgtcctcctcgagttggta
gttgtaagcccatctgctatgaggctgaatgctgtctttgtgaagggcattctggattat
ctggataatatgtcccctcagcaaatacgaaaactcttttgtgttctcagcacactggca
tttagcaaagaacatgaagccaatagtcacatccaggatgacatgcacctggtgatacga
aaacagctgtctagcaccgtattcaagtacaagcttattggtattattggtgctgtcacc
atggctggcgtcatggcagcagatagaagtagatcttccaatttgaccccagggagtgga
gagctgagcagtgaacagtgcacccaggtgacctccttgctacagttggttcattcctgc
agtgagcaatctcctcaggcctctggactttattatgatgaatttgccaacctgatccat
ggaaggaggctagctccagaagtcctggaatggcttgggcagaccatctttaatgatttc
caagatgcgtttgtgttggatgcctgtgatgttccagaaggtgattatccatttcctgtg
aaagcactctacggactagaagactacgatagttgtgatgggattgtcatcaacctcctg
ccactgttgttctctcaggactttgtgaaagatgggagtacacggacttcgcaggaatca
gaccaaaaattggtttctccattatgcctggctccctatttccggttactgagactttgt
gtggacagacaacataatggaaacttggaggagattgatggtttattagattgtcctata
ttcctcactgacctggagcctggagagaggctccagtccatgtctgttaaagaacgttcg
ttcctgtgttcactcatatttcttactctcaactggttccgagaggttgtaaatgccttc
tgtcggcaaaagttgcccgagatgaaggggaaggtgctcacccgattaaagcacattgta
gaactgcagcaactcctggaaaagcacttggcagtcaccccagactatgttcctcccctt
gcaaactttgacttggaaactctagaagaaacacctcataccagtactgccgtttcagca
aaaatcagaatgaaaggaaagacaggaaagaaacgaaaagcagatggcggcaaaacatcc
tcccctgatgtgctttcaaaggacgataattcagaatgtgaccctacactagctgagagg
agccaacaggaaaaggaattcagagggaaagaagaaaagacatcagtgtcattacagaat
taccacgcttttttccgagaaatggacattgaggttttctctattctgcgttgtgggctt
gtgaccaagttcatcttagatactgaaatgcacaccgaagctgcagaagttgtgcaactt
cagccccctgaactgcttttcttgctggaagatctcacccagaagctggacaacatgcta
acacctgtggccaggagagtccccttcctcaagagcaaaggaaaccggaatattggattc
tcacatctccaccagagatctgcctcagaaatcgcgtttagggttgttcaactgctgaac
cccatgtgtaaccatctggagaacattcacaactattttcagtgcttaactgctgagaat
catggtgtagttgatggacctggaattaaaggtcaagagtaccacacaatgtcttcctgc
tatctgaggctactgcagatttttcatgggctttttgcttggagtggattctgtcaactt
caaaataataatttactatactcagcccttgggatccttactagccgactgaagccagga
gagcgtgaccaatccatggaggagctgctcaggcagagcttccattacttgcagaatttc
catgccagcattcccagtttccagtgtgctctttatctccttagacttttgatggtcatt
ttggagaaatctgcagctcctgctgagaacaaaagacaaattgcttccctggccaaacag
ttcctctgtcgagtgtggcctagtggagagaaagagaggagcagcattcctaatgaccag
ctccaggctttgcttggcatctacctggagcacacagacagtgtactgaaggccatagag
gaaattgctggtgttggtgtcccagagctgatcaactctccaaaagaagcctcttcttcc
acattccctacactgacctggaccacgttcgtcattttcttccgagtaatgatggctgaa
ctagagaagacagtgaaaggtcttcaggctggaacagcagcagattcacagcagattcat
gaagagaagctcctctactggaacatggctgttcgagacttcagtatcctcatcaacctg
ataaaggtgtttgatagtcgtcctgttctgtttgcgtgtttgaagtatgggcgtctcttt
gtggaagcatttctgaagcagtgtatgccgctcctagatttcagttttagaaaacaccgg
gaagatgttctgagcttactggaaaccttccagttgagcacgagactgcttcatcacctg
tgtgggcattccaagattcaccaggacacaaaactcaccaaacatgtgcctttgctcaaa
aagaccctggaactgttagtttgccgagtgaaagccatgcttatcctcaacaattgcaga
gaggctttctggctgggcaatcttaaaaatcgggacttgcagggtgaagagattatatcc
cagaattcccaggagagcactgcaaatgagagtgagggtgacacatcattccaaggagca
gagggtggcgaagaagataaagcaagtgatggagaaaaggagcgagagagtgatgaagat
gagagtgatgacgactga

DBGET integrated database retrieval system