KEGG   Bos taurus (cow): 516017Help
Entry
516017            CDS       T01008                                 

Gene name
L1CAM
Definition
(RefSeq) neural cell adhesion molecule L1 precursor
  KO
K06550  L1 cell adhesion molecule
Organism
bta  Bos taurus (cow)
Pathway
bta04360  Axon guidance
bta04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    516017 (L1CAM)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    516017 (L1CAM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:bta04515]
    516017 (L1CAM)
   04090 CD molecules [BR:bta04090]
    516017 (L1CAM)
   04091 Lectins [BR:bta04091]
    516017 (L1CAM)
Cell adhesion molecules [BR:bta04515]
 Immunoglobulin superfamily
  L1 family
   516017 (L1CAM)
CD molecules [BR:bta04090]
 Proteins
  516017 (L1CAM)
Lectins [BR:bta04091]
 I-type lectins (Siglecs)
  516017 (L1CAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set fn3 Ig_2 ig Bravo_FIGEY V-set Ig_5 C2-set_2 Ig_6 BiPBP_C Adeno_E3_CR1
Motif
Other DBs
NCBI-GeneID: 516017
NCBI-ProteinID: NP_001179364
BGD-bta: BT18474
Ensembl: ENSBTAG00000013462
VGNC: 30760
UniProt: E1BBI3
Position
X
AA seq 1257 aa AA seqDB search
MAVALWFLWPLLLCSPCVLIQIPEEYEGHHVMEPPIITEQSPRRVVVFPTDDVSLKCEAS
GKPEVQFRWTRDGILFKPREELGMIVNQVPHSGSFSITGNSSNFAQSFQGTYRCFASNKL
GTAMSHEIQLMAEGTPKWPKETVKPVEVEEGESVILPCHPPPSAEPLRIYWMNSKILHIK
QDERVTMGQNGNLYFANVLTSDNHSDYICHAHFPGTRTIIQKEPIDLRVKATNSMMDRKP
HLLFPTNSSSHLVALQGQPLILECIAEGFPTPTIKWLRPSGPMPADRVTYQNHNKTLQLL
NVGEEDDGEYRCLAENSLGSDRHAYYVTVEAAPYWLHKPQSHLYGPGETARLDCQVQGRP
QPEVTWRINGIPVEELGKDQKYRIHHGALVLSNLQPSDTMVTQCEARNRHGLLLANAYIY
VVELPAKILTPDNETYMAVQGSTAYLLCKAFGAPVPSVQWLDREGKTVLQDERFFPYTNG
TLGIRDLQTNDTGHYFCQAANDQSNVTIVANLQVKDATRIMQGPRSAIEKRGSRVMFTCQ
ASFDPSLQHSTTWRRDALDLQELGDSDKYFIEDERLVIHSLDYSDQGNYSCVASTKLDVV
ESRAELLVVGSPGPVPQLELSDHHLLKQSQVRLSWSPADDHNAPIEKYDIEFEDKEMAPE
KWYSLGKVPGNQTSTTLKLSPYVHYTFRVTAINKYGPGEPSPDSETVVTPEAAPEKNPVD
VKGEGNETNNMVITWKPLRWMDWNAPQVQYRVQWRPQKMQGAWQEQIVSDPFLVVSNTST
FVPYEIKVQTVNSQGKGPEPQITIGYSGEDYPQASPLLEPVKALNSSTVLVRWQSVDPAQ
VKGHLRGYNVTYWWEGSQRKHNKRHVHKGHVVVPANATSTILGGLRPYSSYWVEVQAFNG
RGLGPASGMTFNTPEGVPGHPEALHLECQSDTSLLLHWQPPLSHNGVLTGYVLSYQPLND
GSKEQLSFDLPDPELRTHNLTNLSPRLRYRFQLQATTREGPGEAIVREGGTMALSGMPDF
GNISAMAGENYSVVSWVPKEGQCNFGFQIWFKALGDEKLVARLPPQYVSYNQSSYTQWDL
QPDTDYEIQLLKEQVLLHQMAVKTNGTGRVRLPPAGFATEGWFIGFISAIVVLLLVLLIL
CFIKRSKGGKYSVKDKEDTQVDSEARPMKDETFGEYRSLESDNEEKAFGSSQPSLNGDIK
PLGSDDSLADYGGSVDVQFNEDGSFIGQYSGKKEKEVAGGNDSSGATSPINPAGTLE
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atggccgtggcgctgtggttcttgtggcctctcctcctctgcagcccttgcgtgctcatc
cagatccctgaggaatatgaaggacaccatgtgatggaaccccccatcatcacggagcag
tctccccggcgtgtggtcgtcttccccacagatgacgtcagcctcaagtgtgaggccagc
ggcaaacccgaagtgcagtttcgctggactcgggatggcatcctcttcaaacccagagag
gaactgggcatgatcgtgaaccaggtgccccattctggctccttcagcatcacgggcaac
agcagcaactttgcccagagcttccagggcacctatcgctgctttgccagcaacaagctg
ggcaccgccatgtcccacgagatccagctcatggccgagggtacccccaagtggccaaag
gagacagtgaaacctgttgaggtcgaggaaggggagtcggtgattctcccttgccacccg
ccccccagtgcagagccactccggatctactggatgaacagcaagatcttgcacatcaaa
caggatgagcgggtgaccatgggccagaatggcaacctctactttgctaatgtgctcacc
tcagacaaccactcagactacatctgtcacgcccacttccctggcacccgaaccatcatt
caaaaggaacccattgacctccgggtcaaagcgaccaacagcatgatggacagaaaacca
cacttgctcttccccaccaattccagcagccacctggtggccctgcaggggcagcccttg
atcttggagtgcatagctgagggcttccccacgcccaccatcaagtggctgcgcccaagc
ggccccatgccagccgaccgggtcacctaccagaaccacaacaagacgctgcagttgctg
aacgtgggtgaggaggacgacggcgagtaccgctgcctggctgagaactcgctgggcagc
gaccgccacgcctactacgtcaccgtggaggctgcaccatactggctacacaagccccag
agccatctgtacgggccaggggagactgcccgcctagactgtcaagtgcagggcaggccc
caaccggaggtcacctggagaatcaatgggatccctgtggaggagctgggcaaggaccag
aaataccggatccaccatggagccctggtcctgagcaatctgcagcccagtgacactatg
gtgacccagtgtgaggcccgcaaccgccacgggctcctgctggccaatgcctacatctat
gttgtggagctgccagccaagatcctgaccccagacaatgagacatacatggcagtccag
ggcagcaccgcctaccttctgtgcaaggccttcggagcccctgtgcccagcgtccagtgg
ctggacagggaaggaaagacagtgctgcaggacgagcgcttcttcccctacaccaacggg
accctgggcatccgagacctccagaccaatgacactgggcactacttctgccaggctgcc
aacgaccaaagcaacgtgaccattgtggctaacctgcaggtcaaagatgccactcggatc
atgcaggggccccgcagtgcaatcgagaagagaggctcccgagtgatgttcacatgccag
gcctcctttgacccctccctgcagcacagcaccacctggcgcagggatgctctcgacctg
caggagttgggggacagtgacaagtacttcatagaagacgagcgcttggtcatccacagc
ctggactacagtgaccagggcaactacagctgcgtggccagcaccaagctggacgtggtg
gagagccgggcagagctgctggtggtcgggagccccggacctgtgccccagctggagctg
tctgatcaccacctgctgaagcagagccaggtgcgcctgtcttggagcccagctgatgac
cataacgcccccattgagaagtatgacattgaatttgaggacaaggagatggcacccgag
aagtggtacagcctgggcaaggtgcccggaaaccagacctccaccaccctcaagctgtcg
ccttatgtccactatacctttcgagtcactgccatcaacaaatatggccctggggagccc
agcccggactctgagactgtggtcacgccggaggcagccccagagaagaaccccgtggac
gtgaagggggaaggaaatgagaccaacaacatggtcatcacttggaagccgctgcggtgg
atggactggaatgccccccaggttcagtatcgagtgcagtggcgcccccagaagatgcag
ggggcctggcaggaacagatcgtcagtgaccccttcctggtggtgtccaatacatctacc
tttgtgccgtatgagatcaaagtccagaccgtcaacagccagggcaagggccctgagccc
cagatcaccatcggctactctggagaggactacccccaggcaagccctctgctggaaccc
gtcaaggccctcaattcaagcactgtgctggtcaggtggcagtctgtggacccagcccag
gtcaaaggccacctccggggatacaatgtgacgtactggtgggaaggcagtcagaggaag
cacaacaagaggcacgtccacaaaggccacgtggtggtgccagccaatgccaccagcacc
atcctgggaggcctgcggccctatagctcctactgggtagaggttcaggcctttaacggg
aggggactggggcctgccagtgggatgaccttcaacacccctgagggagtgcctggacac
cctgaggcgttgcacctggagtgccagtcagataccagcctgctgctgcactggcagcct
ccgctcagccataatggtgtgctcacgggctacgtgctctcctaccaacctttgaatgac
gggagcaaggagcagttgtcctttgacctcccggaccctgagctgcggacacacaacctg
accaacctcagcccccgcctgcggtaccgattccagctgcaggccaccacgagggagggc
ccgggggaggcgatcgtacgggaaggaggcaccatggccttgtccgggatgccggacttt
ggcaacatctccgccatggctggcgagaattacagtgtggtctcctgggtccccaaagag
ggccagtgcaacttcgggttccagatctggttcaaagccctgggggacgagaagctggtg
gctcgtctcccaccgcagtacgtcagctacaaccagagctcctacacacagtgggacctg
cagcctgacaccgactatgagatccagctgctcaaggagcaggtgctcctgcaccagatg
gcagtgaagaccaacggcaccggccgagtgaggctgcctcccgctggctttgccactgag
ggctggttcatcggcttcatcagtgccatcgttgtcctgcttcttgtcttactcatcctg
tgcttcattaagcgcagcaagggtggcaagtactcggtgaaggacaaggaggacacccag
gtggactcagaggcccggcccatgaaggacgaaaccttcggcgagtacaggtccctggag
agtgacaatgaggagaaggcctttggtagcagccagccatcactcaacggagacatcaag
cccctgggcagcgatgacagcctggcggactacggaggcagcgtggacgtccagttcaat
gaggatggctccttcatcggccagtacagtggcaagaaggagaaggaggtggcagggggc
aatgacagctccggggccacatcccccatcaaccccgccgggaccctggagtag

DBGET integrated database retrieval system