KEGG   Bos taurus (cow): 516039Help
Entry
516039            CDS       T01008                                 

Gene name
MAP2K3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta04015  Rap1 signaling pathway
bta04218  Cellular senescence
bta04620  Toll-like receptor signaling pathway
bta04664  Fc epsilon RI signaling pathway
bta04668  TNF signaling pathway
bta04714  Thermogenesis
bta04750  Inflammatory mediator regulation of TRP channels
bta04912  GnRH signaling pathway
bta05014  Amyotrophic lateral sclerosis (ALS)
bta05145  Toxoplasmosis
bta05164  Influenza A
bta05169  Epstein-Barr virus infection
Module
bta_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    516039 (MAP2K3)
   04010 MAPK signaling pathway
    516039 (MAP2K3)
   04668 TNF signaling pathway
    516039 (MAP2K3)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    516039 (MAP2K3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    516039 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    516039 (MAP2K3)
  Endocrine system
   04912 GnRH signaling pathway
    516039 (MAP2K3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    516039 (MAP2K3)
  Environmental adaptation
   04714 Thermogenesis
    516039 (MAP2K3)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    516039 (MAP2K3)
  Infectious diseases
   05164 Influenza A
    516039 (MAP2K3)
   05169 Epstein-Barr virus infection
    516039 (MAP2K3)
   05145 Toxoplasmosis
    516039 (MAP2K3)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     516039 (MAP2K3)
Protein kinases [BR:bta01001]
 Serine/threonine kinases: STE group
  STE7 family
   516039 (MAP2K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH Choline_kinase DHR-2
Motif
Other DBs
NCBI-GeneID: 516039
NCBI-ProteinID: NP_001077162
BGD-bta: BT16861
Ensembl: ENSBTAG00000010576
VGNC: 31184
UniProt: A4IFH7
Position
19
AA seq 347 aa AA seqDB search
MESPAPSPPAGVPTSKGKSRRKKDLRISCMSKPPAPSPTLPRNLDSRAFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDVNMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKGMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTSHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagtcccctgccccgagcccgcccgccggcgtgcccacgtccaaaggaaagtccagg
aggaaaaaggatttacgaatctcctgcatgtccaagccgccggcgcccagccccacgctc
ccccggaacctggactcccgggcattcatcaccattggagacaggaactttgaggtggag
gcggatgacctggtgaccatttcagagctgggccgaggtgcctatggggtggtggagaag
gtgcggcatgcccagagtggcaccatcatggccgtgaagcgcatccgggccaccgtgaac
tctcaggagcagaagcgcctgctcatggacctagatgtcaacatgcgcacggtggactgt
ttctacaccgtcaccttctatggggccctctttagagagggagacgtgtggatctgcatg
gagctcatggacacgtccctggacaagttctatcggaaggtgctagacaagggcatgacg
atcccagaagacattctcggggagatcgctgtgtctatcgtgagggccctggaacacctg
cacagcaagctgtccgtgatccacagagatgtgaagccgtccaatgtccttatcaacaag
gagggccacgtgaagatgtgtgactttgggatcagtggttacttggtggattccgtggcc
aagacaatggatgctggctgcaaaccctacatggcccctgagagaatcaacccagaactg
aaccagaaaggctacaatgtcaagtccgatgtctggagcctcggcatcaccatgatcgag
atggccattctgcgatttccttacgagtcctgggggacccccttccagcagctgaagcag
gtggtagaggagccgtccccccagctcccagctgaccgtttctcccctgagtttgtggac
tttactgcacagtgcctgagaaagaaccccgcggaacgcatgagctacctggagctgatg
gagcaccctttcttcacctcgcacaaaaccaagaagactgacatcgctgccttcgtgaag
gagatcctgggagaggactcgtag

DBGET integrated database retrieval system