KEGG   Bos taurus (cow): 516133
Entry
516133            CDS       T01008                                 

Gene name
FGR
Definition
(RefSeq) tyrosine-protein kinase Fgr
  KO
K08891  tyrosine-protein kinase Fgr [EC:2.7.10.2]
Organism
bta  Bos taurus (cow)
Pathway
bta04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    516133 (FGR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bta01001]
    516133 (FGR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    516133 (FGR)
Enzymes [BR:bta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     516133 (FGR)
Protein kinases [BR:bta01001]
 Non-receptor tyrosine kinases
  SRC family
   516133 (FGR)
Membrane trafficking [BR:bta04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    516133 (FGR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9 SH3_10 zf-RING_14 SH3_3
Other DBs
NCBI-GeneID: 516133
NCBI-ProteinID: NP_001092461
BGD-bta: BT22872
Ensembl: ENSBTAG00000011784
VGNC: 28994
UniProt: A5PKG9
Position
2
AA seq 527 aa
MGCVFCKKLEPGAKEDGGLEGDFRNYGAADRYGPDPTQSRPASSFSHIPNYNSFSPQPAS
PAFLDAGTIRGISGIGVTMFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSS
GHTGYIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNSRGAFLIRESETTKGAYSL
SIRDWDQTRGDHVKHYKIRKLDTGGYYITTRAQFDTVQELVQHYLEVNDGLCHLLTAACT
TMKPQTLGLAKDAWEISRSSITLEHRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSPKA
FLAEAQIMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLEFLKGPEGHVLKLPHLVDM
AAQVAEGMAYMERMNYIHRDLRAANILVGERLVCKIADFGLARLIEDDEYNPQQGTKFPI
KWTAPEAALFCRFTIKSDVWSFGILITELITKGRVPYPGMNNREVLEQVEHGYHMPCPPG
CPASLYEVMEQTWRLDPEERPTFEYLQSFLEDYFTSTEPQYQPGDDT
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgggctgtgtgttctgcaagaagttggagccaggggccaaggaggatggtggcctagaa
ggggacttcaggaactatggggctgcagaccgctatggccccgaccctactcagagccgg
cctgcatcttccttttcccacatccccaactacaacagcttctcccctcagcccgccagc
cccgccttcctcgatgcgggcaccatccggggcatctcagggattggggtgaccatgttc
atcgccctttatgactatgaggcccgaacggaggacgatctcaccttcaccaagggcgag
aagttccacatcctgaacaacaccgagggtgactggtgggaggctcggtccctcagctcc
ggacacactggctacattcccagcaactacgtggcccccgtggactccatccaggctgaa
gagtggtacttcggaaagatcgggaggaaggacgctgagaggcagctgctctccccaggg
aactcccgcggggcctttctcattagagagagcgagaccaccaaaggcgcctactccctg
tccatccgggattgggaccagaccagaggcgatcatgtgaagcattacaagatccgcaaa
ctggacaccggtggctactacatcaccacgagggcccagtttgacactgtgcaggagctg
gtgcagcactaccttgaggtgaacgatgggctgtgccatctgctcacggcggcctgcacc
accatgaagccgcagacgctgggcctggccaaggatgcctgggaaatcagccgcagctcc
atcacgctggagcaccgactgggcaccggctgcttcggggatgtgtggctgggcacgtgg
aacggcagcaccaaggtggcggtgaagacgctaaagccgggcaccatgtccccgaaggcc
ttcctggcagaggcgcagatcatgaagctgctgcggcacgacaagctggtgcagctgtac
gcggtggtgtcagaggagcccatctacatagtgaccgagttcatgtgccacggtagcctg
ctggagttcctcaagggcccggagggtcatgttttgaagctgccccatctggtggacatg
gcggcacaggttgctgagggcatggcctacatggagcgcatgaactatattcaccgtgac
ctccgggcagccaacatcctcgtcggggagcggctggtgtgcaagatcgctgacttcggg
ctggcccgactcatcgaagatgacgagtacaacccccagcaagggaccaagttccccatc
aagtggacagcccctgaggctgccctcttttgcagattcactatcaagtcagatgtgtgg
tcctttgggatcctgatcactgaactcatcaccaagggccgagtcccctacccaggcatg
aataaccgcgaagtgttggaacaagtggagcatggctaccacatgccgtgccccccaggc
tgcccagcatccctgtacgaggtcatggaacaaacctggcgtctggacccagaggagaga
cccaccttcgagtacctgcagtccttccttgaggactatttcacctccacagaaccccag
taccagcctggggatgacacatag

DBGET integrated database retrieval system