KEGG   Bos taurus (cow): 516287Help
Entry
516287            CDS       T01008                                 

Gene name
CYB5R1
Definition
(RefSeq) NADH-cytochrome b5 reductase 1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bta  Bos taurus (cow)
Pathway
bta00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    516287 (CYB5R1)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     516287 (CYB5R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 516287
NCBI-ProteinID: NP_001029690
BGD-bta: BT10071
Ensembl: ENSBTAG00000019927
UniProt: Q3MHW9
Position
16
AA seq 305 aa AA seqDB search
MGLQPSPVLLASLGVGLLTLLGVALGAYLVRRSRRPPVTLLDPNEKYQLRLLDKTTVNHN
TKRFRFALPTAHHVLGLPVGKHVYLSARIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKG
VHPKFPEGGKMSQYLDSLKIGDVVEFRGPSGLLTYAGKGKFNIQPNKKAPPEARVARNLG
MIAGGTGITPMLQLIRAILKDPEDPTQCFLLFANQTEKDIILREDLEELQARHPGRFKLW
FTLDHPPEGWAYSKGFVSVDMIREHLPAPGEDVLLLLCGPPPMVQLACHPSLDKLGYSPK
MRFTY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggggctgcagccgagcccggtcctgctggcctccctgggcgtggggctgctgacgctg
ctcggcgtggctctgggcgcctacctggtgcggaggtcccgccggccgccggtcacgctc
ctggaccccaatgagaagtaccagctgcgactgctagacaagacgaccgtgaaccacaac
accaagaggttccgctttgccctgccgacggctcaccacgttctggggctgcctgtgggc
aaacatgtctacctctctgcccggatcgatggcagcctggtcatcaggccgtacactccc
gtcaccagcgatgaggaccagggctacgtggatcttgtcatcaaggtctatctgaagggt
gtgcaccccaaattccctgagggagggaagatgtctcagtacctggatagcctgaagatt
ggggacgtggtggagtttcgggggccaagcgggctgcttacttatgccggaaaagggaag
tttaacatccagcccaacaaaaaggctccaccagaagcgcgcgtggccaggaacctggga
atgattgccggaggcacaggaatcactccaatgctgcagctgatccgggccatcctgaaa
gacccagaagatcccacccagtgctttctgctgtttgccaaccagactgaaaaggacatc
atcttacgagaggacttggaggagctgcaggcccgacaccccggccgctttaagctctgg
ttcaccctggatcaccccccagaaggttgggcctacagcaagggcttcgtctctgtggac
atgatccgggagcacctgcccgctcccggggaagacgtgctgctgctgctctgcgggcca
cccccgatggtgcagctggcctgccaccccagcctggacaaactgggctactcgccaaag
atgcgcttcacctactga

DBGET integrated database retrieval system