KEGG   Bos taurus (cow): 516595
Entry
516595            CDS       T01008                                 

Gene name
PTRH2
Definition
(RefSeq) peptidyl-tRNA hydrolase 2, mitochondrial precursor
  KO
K04794  peptidyl-tRNA hydrolase, PTH2 family [EC:3.1.1.29]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bta03012]
    516595 (PTRH2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.29  aminoacyl-tRNA hydrolase
     516595 (PTRH2)
Translation factors [BR:bta03012]
 Eukaryotic type
  Release factors
   516595 (PTRH2)
 Prokaryotic type
   516595 (PTRH2)
SSDB
Motif
Pfam: PTH2
Other DBs
NCBI-GeneID: 516595
NCBI-ProteinID: NP_001029691
BGD-bta: BT22027
Ensembl: ENSBTAG00000016710
VGNC: 33562
UniProt: Q3ZBL5
Position
19
AA seq 179 aa
MISRSLVMEYLTNPGALSLVAGVACGVCLGWGLRMRFGMLPKSSVRETNPDTETEASILG
ESGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPELLKEWEYCGQPKVVVKA
PDEETLVELLTHAKVLGLTVSLIQDAGRTQIAPGSRTVLGIGPGPADLIDKVTGHLKLY
NT seq 540 nt   +upstreamnt  +downstreamnt
atgatctccagatccctggttatggagtatctgactaatcctggtgcacttagcttggtt
gccggagttgcctgtggcgtgtgcctgggctggggcctccgaatgcgctttgggatgctc
cccaagagctcagtgagggagacaaatcctgacactgaaacggaagcaagtatcctcgga
gagagtggggagtacaaaatgattcttgtggttcgaaatgacttaaagatggggaagggg
aaggtggctgcccagtgctctcatgctgctgtttctgcctacaagcaaattcaaaggaga
aaccctgagttactcaaagagtgggaatactgtggccagcccaaagtggtggtcaaagct
cctgatgaagaaactctggttgaattattgacccatgcaaaagtgctgggactgactgta
agtttaattcaagatgcaggacgtactcagattgcaccaggctctcgaactgttttagga
attggaccaggaccagcagacctaattgacaaggtcaccggtcacctaaaactttactag

DBGET integrated database retrieval system