KEGG   Bos taurus (cow): 517559Help
Entry
517559            CDS       T01008                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
bta  Bos taurus (cow)
Pathway
bta04371  Apelin signaling pathway
bta05034  Alcoholism
bta05165  Human papillomavirus infection
bta05169  Epstein-Barr virus infection
bta05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    517559 (HDAC4)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    517559 (HDAC4)
  Substance dependence
   05034 Alcoholism
    517559 (HDAC4)
  Infectious diseases
   05169 Epstein-Barr virus infection
    517559 (HDAC4)
   05165 Human papillomavirus infection
    517559 (HDAC4)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     517559 (HDAC4)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     517559 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 517559
NCBI-ProteinID: XP_024846045
Ensembl: ENSBTAG00000017764
VGNC: 50611
Position
3
AA seq 1167 aa AA seqDB search
MDLKRNTVKISSLLGALDFVAETAEGSSDLRMEVLARSLPHRHSHRKQRTQWDGLSGRDQ
PVELLNPARVNHMPSTVDVASALPLPVAPPGVPMDLRLDHQFPLPVAEPGLREQQLQQEL
LALKQKQQLQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQELLAMKHQQELLEHQRKLE
RHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCM
SSDPRYWYGKTQHSSLDQSSPPQSGASASYNHPVLGMYDAKDDFPLRKTASEPNLKLRSR
LKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSAPSSPNNSSGNVSTENG
IAPAVPSIPAETSLAHRLVAREGSVGPLPLYTSPSLPNITLGLPATGPSTGAAGQQEAER
LALPALQQRISLFPGTHLAPYLGAAPLERDAGAAPGSLLQHVVLLEQPPTQTPLVTDRYL
AGLGALPLHAQPLVGAERVAPSVHKLRQHRPLGRTQSAPLPQSTQALQHLVIQQQHQQFL
EKHKQHFQQPQLHLNKQPRPKGSCPEVCVPQSNIWMITPDLLSAASGTKMIPKPSEPARQ
PESHPEETEEELREHQALLEEPFLDRLPGQKEAHTLAGVQVKQEPIESDDEETEPPREAE
PGQRPPTEQELLFRQQALLLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASA
TFPMSVQEPPAKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGK
CECIRGRKATLEELQTVHSETHALLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVD
SDTIWNEVHSSGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNS
VAIAAKLLQQRLSVSKTLVVDWDVHHGNGTQQAFYSDPRVLYISLHRYDDGNFFPGSGAP
DEVGTGAGVGFNVNMAFTGGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVE
GHPTPLGGYNLSAKCFGYLTKQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNEL
DPLPEKVLQQRPNANAVRSMEKVIEIHSQYWRSLQRLASTAGYSLVEAQKCENEEAETVT
AMASLSVAVKAPEKRPDEEPMEEEPPL
NT seq 3504 nt NT seq  +upstreamnt  +downstreamnt
atggatttaaaaagaaacaccgtcaagatttcgtccctgttaggagctctcgattttgtg
gcagagacagcagagggatccagtgatcttaggatggaggtgttggcaaggagcctccca
catcggcactctcatcgcaagcagaggacacagtgggatggactttctggccgagaccag
ccggtggagctgctcaaccctgcccgcgtgaaccacatgcccagcaccgtggacgtggcc
tcggccctgcctctgccagtggcccccccgggggtgcccatggacctgcgcctggatcac
cagtttccgctgcccgtggcggagccgggtctccgcgagcagcagctgcagcaggagctc
ctggcgctcaagcagaagcagcagctgcagagacagatcctcatcgctgagttccagagg
cagcacgagcagctgtcgcggcagcacgaggcccagctgcacgagcacatcaagcaacag
caggagctgctggccatgaaacaccagcaggagctgctcgagcaccagcggaagctggag
cggcaccggcaggagcaggagctggagaagcagcaccgggagcagaagctgcagcagctg
aagaacaaggagaagggcaaagagagcgccgtggccagcacggaagtgaagatgaagctg
caggagtttgtcctcaataaaaagaaggccctggctcaccggaacctgaaccactgcatg
tccagcgaccctcgctactggtacgggaagacgcagcacagctcgctggaccagagctcc
ccgccccagagcggggcgtcagcctcctacaaccacccagtcctgggcatgtatgacgcc
aaagacgacttccccctcagaaagacagcttctgaacccaacctgaaattacgctccagg
ctaaagcagaaagtggctgagagacggagcagccccctgctacgcaggaaagatgggcca
gtggtcacggctctgaaaaagcgtcccttggatgtcacagactcggcgtgcagcagtgcc
ccaggctccgcgcccagctcgcccaacaacagctccgggaacgtgagcacggagaacggg
atcgcgcccgccgtccccagcatcccagccgagaccagcctggcacacagactcgtggca
cgagagggctcggtgggtccgctgcccctctacacgtcaccatccctgcccaacatcaca
ctggggctgcccgccaccggcccctccacgggggcggccggccagcaggaggccgagaga
ctggccctccccgccctgcagcagcgcatctccctcttccctggtacccacctcgccccc
tacctgggcgcagcgcctctggagcgggacgcgggggcagccccgggctccctcttgcag
catgtggtcctcctggagcagccgcccacgcagacgcccctcgtcacagaccgctacctt
gcaggcctgggcgcgctgcccctgcacgcgcagcccctggtaggggcggagcgagtggcc
ccctcggtgcacaagctgcggcagcaccgcccgctgggccgcacgcagtcggcgccgctg
ccccagagcacgcaggcgctgcagcacctggtcatccagcagcagcaccagcagttcctg
gagaagcacaagcagcacttccagcagccgcagctgcacctcaacaagcaacctcggcca
aagggctcctgcccagaggtctgcgtccctcaatccaacatctggatgatcactcccgac
ctgctttcagcagcaagcggcaccaagatgatccccaaacccagcgagccggcccggcag
cccgagagccaccccgaggagacagaggaggagctgcgggagcaccaggcgctcctggag
gagcccttcctggaccggctcccagggcagaaggaggcccacacactggccggggtgcag
gtgaagcaggagcccatcgagagtgatgacgaggagacggagcccccgcgggaggcggag
cccggccagcggccgcccacagagcaggagctgctcttcagacagcaagccctcctcctg
gagcagcagcggatccaccagctgaggaactaccaggcgtccatggaggctgctggcatc
cccgtgtcctttggcgggcaccggcccctgtcccgggcacagtcctcccccgcatccgcc
accttccccatgtccgtgcaggagcccccagccaagccaaggttcaccacaggcctcgtg
tacgacactctgatgctgaaacaccagtgcacctgcgggaacaccaacagccacccagag
cacgccgggcgcatccagagcatctggtcgcggctgcaggagaccggcctgcgaggcaaa
tgtgagtgcatccgcggacgtaaggccacgctggaggagctgcagacagtgcactcggag
acacacgccctgctgtacggcacgaaccccctcaacaggcagaaactggacagtaagaaa
cttctaggctcactaacgtccgtgttcgtcaggctgccctgcggtggtgtcggggtggac
agtgacaccatatggaacgaggtgcactcgtcgggggccgcccgcctggccgtgggctgt
gtggtagagctggtcttcaaggtggccacgggggagctgaagaatggctttgctgtggtc
cgccctccaggacaccacgcagaggagagcacgcccatggggttctgctacttcaactcc
gtagccatcgctgccaagcttctccagcaaaggctgagcgtgagcaagaccctcgtggtg
gactgggatgtgcaccatgggaacgggacccagcaggccttctatagcgacccccgcgtg
ctctacatctccctgcaccgctacgacgacggcaacttcttcccgggcagcggcgcgcct
gacgaggtgggcacgggcgccggcgtgggctttaacgtcaacatggctttcaccggcggc
ctggacccccccatgggagacgcagagtacctcgcagccttcaggaccgtggtcatgccg
atcgccagcgagttcgccccggacgtggtgctggtgtcctcgggcttcgatgccgtggag
ggccaccccacgcccctcggaggctacaacctctccgccaagtgtttcgggtacctgaca
aagcagctgatgggcctggccggcggccgggttgtcctggcgctggaggggggccacgat
ctcacagccatctgcgacgcctcggaagcctgcgtctctgccctgctggggaatgagctc
gatcctctcccagaaaaggtcttacagcagagacccaatgccaacgctgtgcggtcgatg
gagaaggtcattgaaatccacagccagtactggcgctccctgcagaggcttgcctccacc
gctggctactccctagtcgaggcccagaagtgtgagaacgaggaagccgagactgttact
gccatggcctcgctgtctgtggcggtgaaggcccctgagaagagacccgacgaggagccc
atggaagaggagccgcctctgtag

DBGET integrated database retrieval system