KEGG   Bos taurus (cow): 518321
Entry
518321            CDS       T01008                                 

Gene name
C1QBP
Definition
(RefSeq) complement component 1 Q subcomponent-binding protein, mitochondrial precursor
  KO
K15414  complement component 1 Q subcomponent-binding protein, mitochondrial
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    518321 (C1QBP)
Glycosaminoglycan binding proteins [BR:bta00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   518321 (C1QBP)
SSDB
Motif
Pfam: MAM33
Other DBs
NCBI-GeneID: 518321
NCBI-ProteinID: NP_001029699
BGD-bta: BT18266
Ensembl: ENSBTAG00000012739
VGNC: 26618
UniProt: Q3T0B6
Position
19
AA seq 278 aa
MFQLLRCVPRVLGTAVAGLRAAAPSLPRLQPASRPCARPFGLLSVRARSVQLPGLLKPRG
PCACGCGCSGLHTEGDKAFVDFLSDEIKEEKKIQKYKSLPKMSGGWELEVNGTEAKLVRK
VAGEKITVTFNINNSIPPAFGGEEEEPSQGQKAEEQEPELTSTPNFVVEVTKDGSSKALV
LDCHYPEDEIGQEDDQSDIFSIKEVSFQATGESDWKDTNYTLNTDSLDWGLYDHLMDFLA
DRGVDNTFADELVELSTALEHQEYISFLEDLKGFVKSK
NT seq 837 nt   +upstreamnt  +downstreamnt
atgttccagctgctgcgctgcgtgccccgcgtcctgggtactgccgtcgctggtctccgc
gccgccgcgccctccctgccgcggctgcagcccgcgtcccggccatgcgcccggcccttc
gggctgctcagcgtgcgtgcgaggtcggtgcagctgcccggcctcctgaagcctcggggg
ccctgcgcttgcggctgcggctgtagcggactgcacaccgaaggagacaaagctttcgtt
gacttcctcagcgatgagatcaaggaggaaaagaagatacagaaatataagtctctcccc
aaaatgtcaggaggttgggaactggaagtgaatgggacggaagccaaattagtgcggaaa
gttgctggagaaaagatcactgtcactttcaacattaacaatagcatcccacctgctttc
ggtggtgaggaggaagaaccctcccaagggcagaaggctgaggagcaggagcctgaattg
acatccactcccaatttcgtggttgaagttacaaaggacggcagcagcaaggcccttgtg
ctggactgccactatccggaagatgagattggacaagaggatgaccagagtgacattttc
tccatcaaggaagtgagttttcaggccaccggcgagtctgactggaaggacacaaattac
acactcaacacagactccctggattggggcttatacgaccacctaatggatttccttgcg
gaccgaggggtggacaacacttttgccgatgaattggtggagctcagcacagccctggag
caccaggagtacatttctttccttgaagacctcaaaggttttgtcaaaagcaagtag

DBGET integrated database retrieval system