KEGG   Bos taurus (cow): 518752Help
Entry
518752            CDS       T01008                                 

Gene name
ARG2
Definition
(RefSeq) arginase-2, mitochondrial precursor
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bta  Bos taurus (cow)
Pathway
bta00220  Arginine biosynthesis
bta00330  Arginine and proline metabolism
bta01100  Metabolic pathways
bta01230  Biosynthesis of amino acids
bta05146  Amoebiasis
Module
bta_M00029  Urea cycle
bta_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    518752 (ARG2)
   00330 Arginine and proline metabolism
    518752 (ARG2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    518752 (ARG2)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     518752 (ARG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 518752
NCBI-ProteinID: NP_001017942
BGD-bta: BT20714
Ensembl: ENSBTAG00000001945
VGNC: 26071
UniProt: Q58DL1
Position
10
AA seq 354 aa AA seqDB search
MSLRSHLSRLLRTQVHSVRKKSVHSVAVIGAPFSQGQKRKGVEYGPAAVREAGLMKRLSD
LGCHLKDFGDLNFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSGGYSCVTVGGDH
SLAIGTISGHARHCPDLGVIWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPG
FSWIKPCISSPSIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMEQTFDLLIG
KRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGIYITEEIHSTGLLSALDLVEVNPR
LAVSEEEAKATASLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESESEERVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgaggagccacctctcgcgtctcctccggacgcaagtgcactccgtccggaag
aagtctgtccactccgtggctgtcattggagccccattctcccagggacagaaaagaaaa
ggagtggaatatggtcctgctgctgtaagagaagctggcttgatgaaaaggctctcggat
ctgggctgccaccttaaagacttcggagatttgaattttactccagttcccaaagatgat
ctctataacaacttgatagtgaatcctcgctcagtgggcctggccaaccaggaactagcg
gaggtggttagccgagctgtgtcaggtggctacagctgtgtcacggtgggaggagaccac
agcctggcaatcggtaccatcagtggccacgcccgacactgcccagaccttggtgtgatc
tgggttgatgcccatgctgacatcaatacacccctcaccacttcatctggaaatctacat
ggacagccagtttcgtttctcctcagagaactacaggacaaggtaccacagctcccagga
ttttcctggatcaaaccttgtatctcttctccaagtattgtatatattggactaagagac
gtggaccctcctgaacattttattttaaagaattatgatatccagtatttttccatgaga
gacatagatcgacttggtatccagaaggtcatggaacagacattcgatctgctgattggc
aaaagacaaaggccaatccatctgagtttcgatattgatgcatttgaccctacactggct
ccagccacaggaacccctgttgtagggggactgacctatcgagaaggcatatatattact
gaggaaatacacagtacagggttgctctcggccctggacctcgttgaagtcaatcctcgg
ttggccgtgtcagaggaggaggccaaggctacagccagcctggcagtggacgtcattgct
tcgagtttcgggcagacgagggagggagggcatattgtctacgaccaacttccaactccc
agctcaccagatgaatcagagagtgaagaacgtgtaagaatttag

DBGET integrated database retrieval system