KEGG   Bos taurus (cow): 519461Help
Entry
519461            CDS       T01008                                 

Gene name
SLC22A1
Definition
(RefSeq) solute carrier family 22 member 1
  KO
K08198  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 1
Organism
bta  Bos taurus (cow)
Pathway
bta04976  Bile secretion
bta05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    519461 (SLC22A1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    519461 (SLC22A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bta02000]
    519461 (SLC22A1)
Transporters [BR:bta02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   519461 (SLC22A1)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    519461 (SLC22A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 DUF2897
Motif
Other DBs
NCBI-GeneID: 519461
NCBI-ProteinID: NP_001094568
BGD-bta: BT10235
Ensembl: ENSBTAG00000008540
VGNC: 34719
UniProt: A7MBE0
Position
9
AA seq 563 aa AA seqDB search
MLTVDDVLEQVGEFGWFQKQTFLILCLLSAAFAPIYVGIVFLAFTPDHRCRSPGVAELSR
RCGWSLAEELNYTVPGPGPESQCLRYEVDWNQSTLGCLDPLASLATNGSPLPLGPCEQGW
VYDTPGSSIVTEFNLVCDDSWKVDLFQSCVNLGFFLGSLGVGYIADRFGRKVCLLATTLT
CASLGVLTAVAPDYTSLLIFRLLQGLVSKGSWTAGYTLITEFVGLGYRRTVAILYQMAFT
VGLVLLSGLAYILPHWRWLQLAVSLPIFLLLFRFWFVPESPRWLLSQKRNTEAIKIMDHI
AQKNGKLPPADLKMLSLEEDVTEKLSPSFIDLFRTPNLRKYTFILMYLWFTSSVVYQGLI
MHVGATGGNLYLDFLYSALVEFPAGFIILVTIDRFGRRYPLATSNLAAGLACFLMIFIPH
DLPWLNIMVACVGRMGITIVFQMVCLVNAELFPTFIRNLGMMVCSSLCDLGGVLTPFLVF
RLMEVWQGSPLILFAALGLVAGGMTLLLPETKGVTLPETIEDAENLQRKAKPKENKIYLQ
VQTSELNTQAAERDASQGTAQQK
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgctcactgtagatgatgtactggagcaggttggggagttcggttggttccagaagcaa
accttcctgatcctgtgcctgctctcggccgccttcgcccccatctacgtgggcatcgtc
ttcctggccttcaccccggaccaccgctgccggagccccggggtggcggagctgagccgg
cgatgcggctggagcctggcggaggagctcaactacacggtgccaggcccgggacccgag
agccagtgcctccgctacgaggtggactggaaccagagcacccttggctgcctggacccg
ctggccagcctggctaccaacggcagccccctgcccctgggcccctgcgagcagggctgg
gtgtacgacacgcccggctcctccatcgtgaccgagtttaacctggtgtgtgatgactct
tggaaggtggacctctttcagtcctgtgtgaacttgggcttcttcctgggctctctggga
gtcggctacatcgcagacaggtttggccgcaaggtgtgcctcttggctaccaccctcacc
tgcgccagcttgggcgtcctgacggccgtggctccggactacacgtccctgctgatcttc
cgcctgctgcaggggctggtcagcaagggcagctggacggctggctacaccctgatcacg
gagttcgtgggcctgggctacagacggacagtggcgatcctctaccagatggccttcacc
gtggggctggtgctgctctccggactggcctacatcctcccgcactggcgctggctgcag
ctggccgtctccctgcccatcttcctgctcctcttccgcttctggtttgtgcccgagtcc
ccccgatggctgttatcgcaaaagagaaacactgaggcgataaagatcatggaccacatt
gcgcaaaagaacgggaagctgcctcctgctgacctgaagatgctgtctctcgaggaggac
gtcactgagaagctgagcccctcattcatagacctgttccgcacgcccaacctgaggaag
tacaccttcatcctgatgtacctgtggttcaccagctccgtggtctaccagggcctcatc
atgcacgtgggcgccaccggcgggaacctctacctggacttcctctactccgctctggtc
gagttccccgcaggcttcatcatcctcgtcaccatcgaccgcttcggccgccgctacccg
ctggccacgtccaacttggcggccgggctggcctgcttcctcatgatctttatcccacac
gatctgccctggttgaatatcatggtagcttgtgttggcagaatggggatcaccatcgtg
ttccagatggtgtgcctggtcaacgccgagctgttcccgaccttcatccggaaccttggc
atgatggtgtgttcctccctgtgtgatttgggtggggttctcaccccgttcctggtcttc
aggctgatggaggtttggcaaggctcgccgctcattttgtttgcggccttggggctggtt
gccgggggaatgacgctgcttcttccggagaccaagggggtcactttgccagagaccatc
gaggatgccgagaacctgcagaggaaagcaaaacccaaagaaaacaagatttaccttcag
gttcaaacatcagaactcaacacacaggcagccgagagagatgcttcgcaggggaccgcg
cagcagaagtga

DBGET integrated database retrieval system