KEGG   Bos taurus (cow): 519486Help
Entry
519486            CDS       T01008                                 

Gene name
NPSR1
Definition
(RefSeq) neuropeptide S receptor
  KO
K08376  neuropeptide S receptor
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    519486 (NPSR1)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Peptide
   Neuropeptide S
    519486 (NPSR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 519486
NCBI-ProteinID: NP_001179906
BGD-bta: BT10715
Ensembl: ENSBTAG00000013768
VGNC: 32216
UniProt: F1MJZ0
Position
4
AA seq 370 aa AA seqDB search
MPANLTEGSAKSNGTGQALNSPVLCTETVTFTAEVEGEEWGSFYYSFKTEQLITLWVLFV
FTIVGNAIVLFSTWRRKRKSRMTFFVTQLAITDSFTGLVNILTDIIWRFTGDFMAPDLVC
RVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQAKVLIMIAWSLSFLFSIPT
LIIFGKRKLSNGEVQCWALWPDDSYWTPYMTIVAFLVYFIPLTIISVIYAIVIRTIWVKS
KAYETVISNCSDGKLCTSYNRGLISKAKIKAIKYSIVIILAFICCWSPYFLFDILDNFSL
LPNTKERFYASVIIQNLPALNSAINPLIYCVFSNSICFPCREQRSRDSRMTCRERTEKHE
MQVLSKPEFM
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaacctcacagagggcagcgccaagtccaatgggactgggcaggcactgaat
tctcctgtcctttgtactgaaacagtgactttcactgcagaggtggaaggagaggaatgg
ggctccttctactactccttcaagactgagcagttgataactctgtgggtcctctttgtt
ttcaccattgttggaaacgccattgtgctgttctctacatggaggaggaagaggaagtcg
agaatgaccttttttgtgactcagctggccatcacagattctttcacaggactggttaac
atcttgacagatatcatttggagattcactggagacttcatggcacctgacctggtctgc
cgcgtggtccgctatttgcaggttgtgctgctctatgcctctacctatgtcctggtgtcc
ctcagcatagacagataccatgccatcgtctaccccatgaagttcctgcaaggagaaaag
caggccaaggtcctcatcatgattgcctggagcctctctttcctgttctccattcctacc
cttatcatatttgggaaaaggaaactctccaatggcgaagtgcagtgctgggccctgtgg
cccgacgactcctactggaccccgtacatgaccatcgtggccttcctggtgtacttcatc
cccctgacaatcatcagtgtcatctatgccattgtgatcagaactatttgggtcaaaagc
aaagcctatgagacagtgatttccaactgctcagatggaaagctgtgcaccagttacaac
cgagggctcatctcaaaggcaaagatcaaggccatcaagtatagtattgtcatcattctt
gccttcatctgctgttggagtccctacttcctctttgacattttggacaatttcagcctc
cttccaaacactaaggagcgtttctacgcctctgtgatcattcagaacctgcctgccttg
aacagtgccatcaaccccctcatctactgtgttttcagcaactccatatgcttcccctgc
agggagcaaagatcacgggattccagaatgacatgtcgggagagaactgagaagcatgag
atgcaggttctgtccaagccagaattcatgtag

DBGET integrated database retrieval system