KEGG   Bos taurus (cow): 519920Help
Entry
519920            CDS       T01008                                 

Gene name
EIF4E2
Definition
(RefSeq) eukaryotic translation initiation factor 4E type 2 isoform 1
  KO
K03259  translation initiation factor 4E
Organism
bta  Bos taurus (cow)
Pathway
bta01521  EGFR tyrosine kinase inhibitor resistance
bta03013  RNA transport
bta04066  HIF-1 signaling pathway
bta04150  mTOR signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04211  Longevity regulating pathway
bta04910  Insulin signaling pathway
Module
bta_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    519920 (EIF4E2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    519920 (EIF4E2)
   04151 PI3K-Akt signaling pathway
    519920 (EIF4E2)
   04150 mTOR signaling pathway
    519920 (EIF4E2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    519920 (EIF4E2)
  Aging
   04211 Longevity regulating pathway - mammal
    519920 (EIF4E2)
 Human Diseases
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    519920 (EIF4E2)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     519920 (EIF4E2)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     519920 (EIF4E2)
Translation factors [BR:bta03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    519920 (EIF4E2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 519920
NCBI-ProteinID: NP_001069263
BGD-bta: BT27983
Ensembl: ENSBTAG00000010598
VGNC: 28410
UniProt: Q0II31
Position
2
AA seq 236 aa AA seqDB search
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKSQSSSKRKAVVPGPAEHPLQYNY
TFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGI
KPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDII
SIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEEFHGLVNSSGR
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagttcgacgcattgaaagatgatgacagtggggaccatgatcagaatgaa
gaaaacagcacacagaaagatggtgagaaggaaaaaacggaacgagacaagagtcagagc
agcagtaagaggaaggctgtcgtccctgggccggccgagcacccactgcagtataactac
actttttggtactccaggagaacccccggccgtcccaccagctcacagagctatgaacag
aatatcaaacagattggcacctttgcctctgtggagcagttctggaggttttacagccac
atggtgcgtcccggggacttgacaggccacagcgacttccatctcttcaaagaaggaatt
aaacccatgtgggaggatgatgcaaataaaaatggcggaaagtggataattcgactgcgg
aagggcttggcatcccgctgctgggagaatctcatcttggctatgctgggggaacagttc
atggttggggaggagatctgcggggctgtggtctctgtccgctttcaggaggacattatt
tccatatggaataagactgccagcgatcaagccaccacggcccgcatacgggatacgctt
cggcgagtgcttaacctacctcccaacaccattatggaatacaaaacccacaccgacagc
atcaaggcctgggaggagtttcatggcctggtgaacagcagcggccgctga

DBGET integrated database retrieval system