KEGG   Bos taurus (cow): 520313
Entry
520313            CDS       T01008                                 

Gene name
GABPB1
Definition
(RefSeq) GA-binding protein subunit beta-1
  KO
K09454  GA-binding protein transcription factor, beta
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    520313 (GABPB1)
   03029 Mitochondrial biogenesis [BR:bta03029]
    520313 (GABPB1)
Transcription factors [BR:bta03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    520313 (GABPB1)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    520313 (GABPB1)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3 AAA_23 LAMTOR5
Other DBs
NCBI-GeneID: 520313
NCBI-ProteinID: NP_001069272
BGD-bta: BT27846
Ensembl: ENSBTAG00000022801
UniProt: Q1RMI3
Position
10
AA seq 383 aa
MSLVDLGKKLLEAARAGQDDEVRILMANGAPFTTDWLGTSPLHLAAQYGHYSTTEVLLRA
GVSRDARTKVDRTPLHMAASEGHASIVEVLLKHGADVNAKDMLKMTALHWATEHNHQEVV
ELLIKYGADVHTQSKFCKTAFDISIDNGNEDLAEILQIAMQNQINTNPESPDTVTIHAAT
PQFIIGPGGVVNLTDETGVSAVQFGNSSTSVLATLAALAEASAPLSNSSETPVVATEEVV
TAESVDGAIQQVVSSGGQQVITIVTDGIQLGNLHSIPTSGIGQPIIVTMPDGQQVLTVPA
TDIAEETVISEEPPAKRQCIEIIENRVESAEIEEREALQKQLDEANREAQKYRQQLLKKE
QEAEAYRQKLEAMTRLQTNKEAV
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgtccctggtagatttgggaaagaagcttttagaagcggcacgagcaggtcaagatgat
gaagttcgtattttgatggctaatggagctccttttactacagactggctgggaacttct
ccacttcatctggcagcacagtatggacattattccaccacagaagtactactccgagct
ggtgtaagtagagatgccagaaccaaagtggaccgaacgccattgcatatggctgcctct
gagggccacgccagcatagtggaagttttgcttaagcatggtgctgatgttaatgcaaag
gacatgttgaagatgacagctttacattgggccacggaacacaatcatcaagaggtggtg
gaacttttaatcaaatatggtgctgatgtacacacgcaaagtaaattttgtaaaactgca
tttgatatttcaatagacaatggaaatgaagatttagcagagatactacagattgctatg
cagaaccaaatcaacacaaacccagagagtcccgacactgtgacgatacatgctgcaaca
ccgcagtttatcattggacctggaggggtggtgaacctaacagatgaaacgggtgtgtct
gctgttcagtttggaaactcctctacgtcagtattagctacgttagctgccttagctgaa
gcctctgctccactgtccaattcttccgaaactccagtagtggctacggaggaagtagtt
actgcagaatctgtggatggtgcaattcagcaagtagttagttcagggggtcagcaagtc
atcacaatagttacagatggaattcagcttggaaatttgcactccattccaacaagtgga
ataggtcagcccatcattgtgaccatgccagatggacaacaagtattaacagtaccagca
acggacattgctgaagaaactgttataagtgaagaaccgccagccaaaagacaatgtatt
gaaataattgaaaaccgggtggagtctgcagaaatagaagagagagaagctcttcagaaa
cagctggatgaagctaatcgagaagcacagaaataccgacagcaacttctaaagaaagaa
caggaagcagaggcctacagacagaaattagaagctatgacgcgtcttcagactaataaa
gaagctgtttaa

DBGET integrated database retrieval system