KEGG   Bos taurus (cow): 520956
Entry
520956            CDS       T01008                                 

Gene name
ABHD17C
Definition
(RefSeq) alpha/beta hydrolase domain-containing protein 17C
  KO
K01076  abhydrolase domain-containing protein 17 [EC:3.1.2.22]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bta01002]
    520956 (ABHD17C)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     520956 (ABHD17C)
Peptidases and inhibitors [BR:bta01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   520956 (ABHD17C)
SSDB
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Peptidase_S9 UPF0227 DUF818 DLH Abhydrolase_5 FSH1 Abhydrolase_2 Asp2
Other DBs
NCBI-GeneID: 520956
NCBI-ProteinID: NP_001092484
Ensembl: ENSBTAG00000032951
UniProt: A5PKD9
Position
21
AA seq 329 aa
MPEPGPRMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVLAPEQRGPGAPAPASA
ASTSSASAAAQPAPQQPEEGGAGPGACSLHLSERADWQYSQRELDAVEVFFSRTARDNRL
GCMFVRCAPSSRYTLLFSHGNAVDLGQMCSFYIGLGSRINCNIFSYDYSGYGVSSGKPSE
KNLYADIDAAWQALRTRYGVSPENIILYGQSIGTVPTVDLASRYECAAVILHSPLMSGLR
VAFPDTRKTYCFDAFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYERCPRAVEPLWV
EGAGHNDIELYAQYLERLKQFISHELPNS
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcccgagccaggccccaggatgaacggcttctcgctgggcgaactgtgctggctcttc
tgctgcccgccctgcccgagccgcatcgccgccaagctggccttcctgccgcccgagccc
acctacacggtgctggcgccggagcagcgcggccccggcgcgcccgctccggcctcggcc
gcttccacctcctccgcctccgccgcggcccagccggcgccgcagcagcccgaggagggg
ggcgcggggcccggcgcgtgcagcctgcacctgagcgagcgcgccgactggcagtactcg
cagcgcgagctggacgccgtcgaggtcttcttctcgcgcaccgcccgggacaaccggcta
ggctgcatgttcgtgcgctgcgcgccctccagccgctacacgctgctcttctcgcacggc
aacgcggtggacctgggccagatgtgcagcttctacatcggcctgggctcgcgcatcaac
tgcaacatcttctcctacgactactccggctacggcgtcagctccggcaagccctccgag
aagaacctctacgccgacatcgacgccgcgtggcaggcgctgcgcacccggtatggcgta
agtcccgagaacatcatcctgtatggtcagagcattgggacggtccccacggtagacctg
gcctccaggtatgaatgtgctgcggtgattctccattcgcctctgatgtctggattgcgt
gtggcttttcccgacaccaggaaaacgtactgctttgacgccttccccagcattgacaag
atctccaaagtcacctctcctgtgttggtcattcacggcacagaggacgaggtcatcgac
ttctcccacggcctggccatgtacgagcgctgtccccgggccgtggagccgctctgggtc
gaaggggccgggcataatgacatagagctttacgcacaatacctagagagactaaaacag
ttcatttctcacgaacttcccaattcctga

DBGET integrated database retrieval system