KEGG   Bos taurus (cow): 521027
Entry
521027            CDS       T01008                                 

Gene name
SLC22A2
Definition
(RefSeq) solute carrier family 22 member 2 isoform X1
  KO
K08199  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 2
Organism
bta  Bos taurus (cow)
Pathway
bta05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    521027 (SLC22A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bta02000]
    521027 (SLC22A2)
Transporters [BR:bta02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   521027 (SLC22A2)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    521027 (SLC22A2)
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-GeneID: 521027
NCBI-ProteinID: XP_002690417
BGD-bta: BT10814
Ensembl: ENSBTAG00000009583
UniProt: E1BHW6
Position
9
AA seq 549 aa
MPTVDDILEHIGEFNFFQKQTFFLLCLISAAFTPIYVGIVFLGFTPDHRCRSPGVAELSR
RCGWSLAEELNYTVPGPGPEGQCLRYEVDWNQSTLGCLDPLASLATNGSPLPLGPCEQGW
VYDTPGSSIVTEFNLVCADSWMLDLFQSAVNVGFFIGSMSIGYIADRFGRKLCLLITILI
NASSGVLMAISPNYTWMLIFRLIQGLVSKAGWLIGYILITEFVGLRYRRTVGIFYQVAFT
IGLLVLAGVAYVLPHWRWLQFTVTLPNFCFLLYYWCVPESPRWLISQNKNAKAMKIIKHI
AKKNGKPLPGSLQSLRPDEEVGEKLNPSFLDLVRTPQIRKHTLILMYNWFTSSVLYQGLI
MHMGLAGSNIYLDFFYSALVEFPAAFLIILTIDRIGRRYPWAVSNMVAGAACLVSVFIPE
DLHWLRVTAACLGRMGITMAYEMVCLVNAELYPTFIRNLGVLVCSSMCDIGGILTPFLVY
RLTDIWHELPLVVFAVVGLIAGGLVLLLPETKGKTLPETIEEAENMQRSGKNKEKMIYIE
VKKLDTPLN
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgccgacggtggacgacatcctagagcacatcggggaattcaactttttccagaaacaa
acgttcttcctcctctgcctgatctcggccgccttcacccccatctacgtgggcatcgtc
ttcctgggcttcaccccggaccaccgctgccggagcccaggggtggcggagctgagccgg
cgatgcggctggagcctggcggaggagctcaactacacggtgccgggcccgggacccgag
ggccagtgcctccgctacgaggtggactggaaccagagcacccttggctgcctggacccg
ctggccagcctggctaccaatggcagccccctgcccctgggcccctgcgagcagggctgg
gtgtacgacacgcccggctcctccatcgtgaccgagtttaacctagtgtgtgccgactcc
tggatgctggacctgtttcagtcggcggtgaatgtaggattttttatcggttctatgagt
atcggctacatagcagacaggtttggccgtaagctctgcctcttgattacaatcctcata
aacgcttcatctggagtgctcatggccatctccccaaactacacatggatgctaattttt
cgcttgatccaaggactggtcagcaaagcaggctggttaataggctacatcctgattaca
gaatttgtcgggctgagataccggaggacagtggggattttctaccaagtggccttcacg
attggactcctcgtgcttgctggggtggcctatgtgcttccgcactggagatggcttcag
ttcaccgtgactctgcccaacttctgcttcttgctgtattactggtgtgtgcctgagtct
cctcgatggctgatctcccagaacaaaaatgctaaagccatgaagatcattaagcatatt
gcaaagaaaaacggaaaacccttgcctggatctctccagagcctcagacctgatgaggaa
gttggtgagaagctgaatccttcatttcttgacttggtcagaaccccacagataaggaaa
cacaccttgatcttgatgtacaactggttcacgagctctgttctctaccagggcctcatc
atgcacatgggccttgcgggcagcaacatctacctggacttcttctactctgccctggtc
gagttccctgctgccttcctcatcatcctcaccattgaccgcataggtcgccgttatcca
tgggccgtatcaaatatggtggcgggggcagcctgtctggtctcggtttttatccctgag
gatctacactggctaagagttacggctgcttgcctgggtcggatggggatcacaatggcc
tatgagatggtctgcctggtcaacgcggaactgtaccccacgttcatcaggaacctcggg
gtcctcgtgtgctcctccatgtgtgacatcgggggcatcctcacccccttcctggtctac
aggctcaccgacatctggcacgagctccccctggtggttttcgctgtggttggcctgatt
gctggaggattagtgctgttgctcccagaaaccaaagggaagactttgcctgagaccatt
gaagaagctgagaacatgcagaggtcaggaaaaaacaaagaaaagatgatttacattgaa
gtcaagaaactagacactccactaaattaa

DBGET integrated database retrieval system