KEGG   Bos taurus (cow): 521254
Entry
521254            CDS       T01008                                 

Gene name
BPNT1
Definition
(RefSeq) 3'(2'),5'-bisphosphate nucleotidase 1
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bta  Bos taurus (cow)
Pathway
bta00920  Sulfur metabolism
bta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    521254 (BPNT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bta03016]
    521254 (BPNT1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     521254 (BPNT1)
Transfer RNA biogenesis [BR:bta03016]
 Eukaryotic type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    521254 (BPNT1)
SSDB
Motif
Pfam: Inositol_P
Other DBs
NCBI-GeneID: 521254
NCBI-ProteinID: NP_001029711
BGD-bta: BT13700
Ensembl: ENSBTAG00000004064
UniProt: Q3ZCK3
Position
16
AA seq 308 aa
MASSPTVLMRLVASAYSIAQKAGTIVRRVIAEGDLGIIEKTCATDLQTKADRLVQVSICS
SLARKFPKLTIIGEEDLPPEDVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYQAGPDAVLGRTIWGVLGLGAFGF
QLKEAPAGKHIITTTRSHNSQLVTDCITAMNPDDVLRVGGAGNKIIQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLATLRNYDYYASRVPQ
SVKNALVP
NT seq 927 nt   +upstreamnt  +downstreamnt
atggcatccagtcccactgtgttgatgcggttggtggcttcagcatattctattgctcaa
aaggcaggaacgatagtcaggcgtgttatcgccgaaggagacctgggtatcattgagaag
acctgtgcaacagacctgcagaccaaggctgaccgattagttcaagtgagcatatgttct
tcattggcacggaagttccccaaactaacaattataggggaagaggatctgcctcctgaa
gacgtggatcaagagctgattgaagatggtcagtgggaggagatactgaagcagccgtgc
ccatcacagtacagtgctatcaaggaggaagatcttgtggtctgggttgatcctctggat
gggaccaaggaatatactgaaggtcttcttgacaatgtaacagtacttattggaattgct
tatgaaggaaaagccatagcaggagttattaaccagccatattacaactaccaggcagga
ccagatgctgtgctggggagaactatctggggagttttgggtttaggtgccttcgggttt
cagctgaaagaagcgcccgccggcaaacacatcatcacaacaacccggtcccataacagc
cagttggttacggactgcatcactgctatgaaccctgatgatgtgctgagagtgggagga
gcaggaaataagataattcagctgattgaaggcaaagcctctgcttatgtatttgcaagt
ccaggatgcaagaagtgggacacctgtgctccagaagtcattttacatgctgtcggaggc
aagttaaccgatatccatggaaatgctcttcagtataacaaggaagtgaagcacatgaac
tcggccggagtcctggccacactgaggaattatgactattatgcaagtcgagtcccccag
tctgttaaaaatgcccttgttccttga

DBGET integrated database retrieval system