KEGG   Bos taurus (cow): 521728
Entry
521728            CDS       T01008                                 

Gene name
ATP13A4
Definition
(RefSeq) probable cation-transporting ATPase 13A4 isoform X1
  KO
K14951  cation-transporting P-type ATPase 13A3/4/5 [EC:7.2.2.-]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    521728 (ATP13A4)
SSDB
Motif
Pfam: E1-E2_ATPase P5-ATPase Hydrolase Cation_ATPase_N Cation_ATPase DUF2620
Other DBs
NCBI-GeneID: 521728
NCBI-ProteinID: XP_002684905
BGD-bta: BT10458
Ensembl: ENSBTAG00000016305
VGNC: 26280
UniProt: F1N272
Position
1
AA seq 1197 aa
MGDHFEKGQHALLNEGEENEMEIFGYRTQSCRETLCLAGSIFSFGILPLVFYWKPAWHVW
ANCIPCSLQEADVVLLRTTDEFQTYSRKKVMWICLSALNSAFRLNPDNPFITDEESIINR
AIRKPDLKVRCIKVQKIRYVWDNLEGQFRKIGCLEDWLSSAKIHLKFGSGLTTEEQEIRR
LICGPNTIDVEITPIWKLLIKEVLNPFYVFQLFSVCLWFSEDYKEYAFAIIIMSIISIAL
TVYDLREQSVKLHRLVEAHNNITVSIYGKNAGVQELESRFLVPGDLLILMGNKVQMPCDA
ILIDGSCVVNEGMLTGESIPVTKTPLPKVDGSVPWKTQSEGEYKRHVLFCGTEVIQAKGA
CSSPVKAVVLQTGFNTAKGDLVRSILYPKPMNFKLYRDAIRFLLCLVGTATIGMIYTLCV
YVLSGETPGEVVKKALDVITIAVPPALPAALTTGIMYAQRRLKKRGIFCISPQRINVCGQ
LNLVCFDKTGTLTRDGLDLWGVVPCDGNGFQEVHSFTSGRTLPWGPLYAAMTSCHSLILL
DGTIQGDPLDLKMFEATTWEMVVSRDDFQLKGVPGCAMVVKPCGTSSQVPVEGIAILHQF
PFSSVLQRMTVIVQEMGGDQLVFMKGAPERVASFCQPETVPTSFVSELQIYTTQGFRVIG
LAYKKLEMDHHISALMRDQVESDLIFLGLLILENRLKEETKSVLEELISARIRTVMITGD
NLQTAITVARKSGMVSESQKVILIEANETTGSSSASISWKLLEEKKHIACRNQDSYINIR
EEISDNSKEGSYHFALNGKSFQVISQHFSSLLPKILMNGTIFARMSPGQKSSLVEEFQKL
DYFVGMCGDGANDCGALKMAHVGVSLSEQEASVASPFTSKTPNIECVPHLIKEGRAALVT
SFCMFKYMALYSMIQYVGVLLLYWETNNLSNYQFLFQDLAITTIIGVTMNLNGAYPKLVP
FRPAGRLISPPLLLSVILNILLSLAMHIVGFILVQRQPWYSLGIHSACTVQNDTISKLTV
SPTAPVKNGTNGVFTSFENTTIWFLGTINCIIVALVFSKGKPFRQPTYKNYIFVLVLVVQ
LSVCLFILFADIPELYRCLDLLCTPVLWRVYIVIMLSSNFIVSLVVEEAIIENRALWMII
KRCFGYQSKSQYRILQRALANDPSWPPINQTSDSDMPECGRGVSYSNPVFESNEDQL
NT seq 3594 nt   +upstreamnt  +downstreamnt
atgggggaccactttgagaagggccagcacgctttgctcaatgaaggagaagaaaatgag
atggagatatttggctaccggactcagagttgccgggaaaccctctgccttgctggatcc
atcttctcctttgggatccttcccttggtgttttactggaaacccgcttggcacgtgtgg
gcaaattgcatcccatgctccttgcaagaggcagatgtcgtgttgctgaggacaacggat
gaattccaaacttactctcggaaaaaggtaatgtggatctgcctgtcagccttgaacagc
gcatttaggctcaatcctgacaatcctttcatcaccgacgaggagagcatcataaataga
gccataagaaagccagacctaaaggtgaggtgcataaaagtgcagaaaataagatatgtt
tgggacaacttggagggacagttccggaaaattggctgtttggaagactggctaagttct
gccaagatacacctaaagtttggatctggtctgacaacagaagaacaagaaattaggagg
ttaatatgtgggccaaatactattgatgttgaaatcacacccatttggaagctgctcatc
aaggaggttttaaatccgttttatgtatttcaactcttcagtgtctgtctgtggtttagt
gaagactataaggagtatgcttttgccatcataatcatgtccatcatttccatcgctttg
actgtatatgatctcagagagcaatctgtaaagctccaccgtttagttgaagcacataat
aacattacagtctctatatatgggaaaaatgctggagtccaggagctagaatcacgcttc
ctggtgcctggagatctattaattctgatggggaacaaagtgcaaatgccatgtgatgct
attctgattgatggcagctgtgtggtgaatgaaggcatgctgacaggagaaagtattcca
gtcactaaaactccattacctaaggtggatggctcagtgccctggaaaacacagagtgaa
ggggagtacaagcggcatgtcctcttctgtggaacggaggttatccaggccaagggggcc
tgctccagccctgtgaaagcagtggtactgcagacaggattcaacaccgcaaagggagac
ctcgtgagatccattctctaccccaagccgatgaattttaagctctacagagatgccatc
aggttcctcctgtgcctcgtagggacagccaccattgggatgatctatactttgtgcgtc
tatgtgctcagtggggaaactcccggggaggtagtgaagaaagcccttgacgtcatcaca
attgcagttcctcccgctctgcctgctgctctgaccacaggcattatgtatgcccagagg
aggctgaagaagagaggcatcttctgcattagcccccagaggatcaacgtatgtggacaa
ttaaacctggtctgctttgacaagacaggcaccttaacaagggatggcttggatctctgg
ggagtcgtgccttgtgatgggaacggtttccaggaagtccacagctttacctcaggcagg
actttgccatggggcccactgtatgcagccatgaccagctgccactctctgatccttctc
gatgggaccatccagggagacccactggacctcaaaatgtttgaggccaccacctgggaa
atggtggtttccagggacgatttccaactcaagggagtgccaggatgtgccatggttgtt
aagccctgtggaacatccagtcaggtcccagtggaaggaattgcaatcctgcatcagttc
ccattctcatcagtgctgcagaggatgacagtcattgtccaagagatggggggtgaccag
ctggtgttcatgaaaggtgcaccagagagggtggccagcttttgccaacctgagacagta
ccaactagttttgttagtgaacttcagatttacacgacacagggcttccgggtcatagga
ctggcctacaaaaagctggaaatggatcaccacatctctgccttgatgagggaccaggta
gaatcagacctgatatttctgggactgcttatcttggagaatcgactgaaggaagagaca
aaatctgtccttgaagagcttatctcagcccggataaggactgtgatgatcacaggtgac
aatcttcagactgcaataacagtggccagaaagtctggaatggtttctgaaagccagaaa
gtcattctcattgaagcaaatgaaactacggggtcctcatcagcatctatttcttggaaa
ctactagaagagaagaaacacattgcatgcaggaatcaggacagttacattaatatcagg
gaagaaatctctgataatagcaaagaaggaagttaccattttgctctaaatggaaaatcc
ttccaggttataagtcaacatttcagtagcctactgccaaagatactgatgaatggaacc
atctttgcaagaatgtctccagggcagaaatccagtctggtggaagaatttcagaaacta
gattactttgtaggtatgtgtggtgatggagccaatgactgtggggctttgaaaatggct
catgtgggcgtctctttatcagagcaggaggcgtctgtggcttcgccttttacctccaaa
actccaaacattgaatgtgtacctcatcttatcaaggaaggccgtgcagctctcgtcacc
tcattttgcatgtttaagtacatggctttgtacagcatgattcaatatgttggtgttctg
ctgctctactgggagacaaacaacctttcaaattaccagtttctgttccaggatctggcc
attacaactattattggtgtaacaatgaatttgaatggtgcctatcccaagctggtgcct
ttcagaccagcaggacggctgatctccccacctctgctgctctccgtgattctcaacatt
cttctcagcctcgccatgcacattgtgggcttcattctggttcagaggcagccttggtat
tccttggggatacacagtgcctgcacagtgcaaaatgacaccatttcaaagttaaccgtt
tctccaactgctccagtaaagaatggaactaatggtgtcttcacaagttttgagaacact
actatatggttcttgggaacaatcaactgcatcattgtggctcttgtcttctctaaagga
aaaccatttaggcagcccacatacaaaaactatatatttgtccttgtgctggtcgtacag
ctgagtgtgtgtctattcattctatttgctgatattccagaattatataggtgcctggat
ctgctctgcactcctgtcctgtggagggtctacattgtcattatgctgagctccaatttc
attgtgtcccttgtcgtggaggaggccattattgaaaatagagccctgtggatgataatc
aaaagatgttttggctatcagtcaaaaagccagtatcggatattgcagagagccttggca
aatgaccccagttggcccccaataaaccagacctccgactctgatatgccagaatgtggc
aggggagtgtcttacagcaacccagtgtttgagagcaacgaggatcaactatga

DBGET integrated database retrieval system