KEGG   Bos taurus (cow): 521748
Entry
521748            CDS       T01008                                 

Gene name
TNFSF9
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 9
  KO
K05472  tumor necrosis factor ligand superfamily member 9
Organism
bta  Bos taurus (cow)
Pathway
bta04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    521748 (TNFSF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bta04052]
    521748 (TNFSF9)
Cytokines and growth factors [BR:bta04052]
 Cytokines
  Tumor necrosis fators
   521748 (TNFSF9)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 521748
NCBI-ProteinID: NP_001306831
BGD-bta: BT17325
Ensembl: ENSBTAG00000046266
VGNC: 36178
UniProt: G3MZW3
Position
7
AA seq 252 aa
MHSSNLATPDPEAQRSPAPPGRVCNPLPWALSAALLLLAAACATCVVRVWGVPGTPASPV
SSPAPSSILPVGLEQTSDPHARLPNSPQQGVFAQLVVADGAQLTEGPVQWRSEQGLTGVT
LAPGVHYDKRTQELVVPEAGVYYVFLHLTLKRVMAGNRNGSDSISVALDLQPYQAGAALT
LTLDLPPPPLGNSAAGFRSSLLHLDAGQRLSVHLRPRIREPLSWQLSAEATVWGLFRVAT
QVPSGLPLSKLT
NT seq 759 nt   +upstreamnt  +downstreamnt
atgcactccagcaacctcgccaccccggaccccgaggcccagcggtcgcccgcgcccccg
ggtcgcgtctgcaacccgctgccctgggctctgagcgccgcgctgctgctgcttgccgct
gcctgcgccacctgcgtggtgcgggtctggggcgtccccgggacccctgcctcgccggtt
tccagtccagcgcccagctcgattctccccgtgggcctggagcagacttccgacccccac
gcccgcctccccaactctccgcagcagggcgtgttcgcgcagctggtggtggccgatggt
gcacagctgaccgaagggccggtgcagtggcgtagcgagcaggggttgacaggtgtgact
ctggcgccaggcgtgcactacgacaagcgcacccaagagctggtggtccccgaggccggg
gtctactatgttttcttgcacttgaccctgaagcgcgtgatggcgggcaaccgcaacggc
tccgactccatctccgtggccctggacctgcagccttaccaagccggggccgccctaacc
ctgaccttggacttgccacccccacccttggggaactcagcagctggtttccggagcagc
ttgctgcacctggatgcggggcagcgcttgagcgtccacttgcgccccaggatccgggag
cctctctcctggcagctctcagccgaagccacggtctggggcctcttccgcgtggccacc
caagttcccagtggacttcccttgtcaaagctcacgtga

DBGET integrated database retrieval system