KEGG   Bos taurus (cow): 522529Help
Entry
522529            CDS       T01008                                 

Gene name
ADSS
Definition
(RefSeq) adenylosuccinate synthetase isozyme 2
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta00250  Alanine, aspartate and glutamate metabolism
bta01100  Metabolic pathways
Module
bta_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    522529 (ADSS)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    522529 (ADSS)
Enzymes [BR:bta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     522529 (ADSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt Spore_YpjB
Motif
Other DBs
NCBI-GeneID: 522529
NCBI-ProteinID: NP_001161281
BGD-bta: BT16517
Ensembl: ENSBTAG00000013885
VGNC: 25700
UniProt: A7MBG0
Position
16
AA seq 456 aa AA seqDB search
MAFAETNPAASSLPNGDCGRPRTRPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRC
QGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGL
EGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLR
MCDLVSDFGGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMERIKPMVRDGVYFLYE
ALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAY
TTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALAL
TKLDILDMFTEIKVGVAYKLDGEIIPHFPANQEVLNKVEVQYKTLPGWNTDISNARTFKE
LPINAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgccgagaccaacccggcggcatcctccttgcccaacggcgactgcggccgc
cccaggacgcggcctggagggaaccgggtaacggtggtgctcggcgcgcagtggggcgac
gaaggcaaggggaaggtggtagatctgctagcgcaggacgccgacatcgtgtgccgctgc
cagggaggaaataatgctggccatacagttgttgtagattctgtggagtatgattttcac
cttttacccagtggaataattaacccaaatgttactgcattcattggaaatggtgtggtg
attcatttacctggattgtttgaggaagcagaaaaaaatgttcaaaaaggaaaaggtctg
gaaggctgggagaaaaggcttatcatatctgacagagcccatattgtatttgattttcat
caagcagctgatggtatccaggaacaacagagacaagaacaagcaggaaaaaatttgggt
accacaaaaaagggcattggcccagtttattcttccaaagctgctcggagtggactcagg
atgtgcgatcttgtttctgactttggtggcttctctgagaggttcaaagttctggctaac
cagtacaaatctatataccctactttggaaatagacattgaaggtgaattacaaaaactc
aagggttatatggaaaggattaagccaatggtgagagatggagtttatttcctgtatgaa
gctctccatggaccaccaaagaaaatcttggtagaaggtgcaaatgcagcactactagat
attgattttggaacttatccttttgtgacctcttcgaactgtacagttggaggtgtgtgt
actggcttgggtatgccccctcaaaacgttggagaagtgtatggagttgtgaaagcttat
acaactagagttggtattggtgcctttcctacagaacaagacaatgaaattggagaatta
ttacaaacaaggggtagagagttcggtgtaacgacaggaaggaaaagaagatgtggctgg
ttggaccttgttttgctcaaatatgctcatatgattaatggatttactgcgttggcactt
accaaattggatattttggacatgtttacggaaatcaaagttggagttgcatacaaatta
gatggtgaaattatacctcattttccagcaaaccaagaagtcttaaataaagttgaagtt
cagtataagactctcccaggatggaacacagacatatcaaatgcaaggacttttaaggaa
ctacctattaatgcacaaaactatgttcgatttattgaagatgaacttcaaattccagtt
aaatggattggtgtaggtaaatccagagaatctatgattcagctcttttaa

DBGET integrated database retrieval system