KEGG   Bos taurus (cow): 523311Help
Entry
523311            CDS       T01008                                 

Gene name
GPX7
Definition
(RefSeq) glutathione peroxidase 7 precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bta  Bos taurus (cow)
Pathway
bta00480  Glutathione metabolism
bta00590  Arachidonic acid metabolism
bta01100  Metabolic pathways
bta04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    523311 (GPX7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    523311 (GPX7)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    523311 (GPX7)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     523311 (GPX7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 523311
NCBI-ProteinID: NP_001094583
BGD-bta: BT26802
Ensembl: ENSBTAG00000018281
VGNC: 29621
UniProt: A6QLY2
Position
3
AA seq 186 aa AA seqDB search
MVAARAAAWLLLAAAACAPREQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVT
GTGAHPAFKYLTETSGKEPTWNFWKYLVAPDGKVIGAWDPTVSVEEIRPQITALVRKLIL
KKREDL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggcacgggcggcggcgtggctgctcctggctgcggcggcctgcgcgccgcgg
gagcaggacttctacgacttcaaggccgtcaacatccggggcaagttggtgtcgctggag
aagtaccgaggctcggtgtccctggtggtgaacgtggctagcgagtgtggcttcacagac
cagcactatcgggccctgcagcagctgcagcgggacctggggccccaccacttcaatgtg
cttgccttcccctgcaaccagtttggccagcaggagcccgacagcaacaaggagatcgag
agctttgcccgccgcacatacagtgtctctttccccatgtttagcaagattgcagtcacc
ggcactggtgcccaccctgccttcaagtacctgactgagacttctgggaaggagcctacc
tggaacttctggaagtacctggtggccccagatggaaaggtgataggagcttgggaccca
actgtgtcggtggaggaaatcaggccccagattacagcgcttgtgaggaaactcatcctg
aagaagcgagaagacttataa

DBGET integrated database retrieval system