KEGG   Bos taurus (cow): 523822Help
Entry
523822            CDS       T01008                                 

Gene name
TNFRSF11B
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 11B precursor
  KO
K05148  tumor necrosis factor receptor superfamily member 11B
Organism
bta  Bos taurus (cow)
Pathway
bta04060  Cytokine-cytokine receptor interaction
bta04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    523822 (TNFRSF11B)
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    523822 (TNFRSF11B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bta04050]
    523822 (TNFRSF11B)
Cytokine receptors [BR:bta04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   523822 (TNFRSF11B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death Ephrin_rec_like
Motif
Other DBs
NCBI-GeneID: 523822
NCBI-ProteinID: NP_001091525
BGD-bta: BT10538
Ensembl: ENSBTAG00000007423
VGNC: 36161
UniProt: A5D7R1
Position
14
AA seq 402 aa AA seqDB search
MNKLLCCALVFLDISIKWTTQETFPPKYLHYDPESSRQLMCDKCPPGTFLKQPCTARRKT
VCAPCPDHYYTDTWHTSDECLYCSPVCKELQYVKQECSRTHNRVCECEEGRYLELEFCLK
HRSCPPGFGVLHPGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSAFGLLLTQKGNAT
HDNICSGSSESSTHKCGIDMTLCEEAFFRFAVPTKLTPNWLSVLVDNLPGTKVNAESIER
IKQRHNSREQTFQLLKLWKHQNKDQDMVKKIIQDIDLCENSVRRHIGHLNLTFEQLLKLM
ESLPGKKVTTEDVEKTVKTCKSSEQLLKLLSLWRIKNGDQDTRKGLLHALKHLKTYHFPK
TVIQSLKKTIRFLHSFTMYRLYRKLFLEMIGNQVQSLKISCL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagttgctgtgctgcgcgctcgtgttcctagacatctccattaaatggaccacc
caggaaacctttcctccaaagtaccttcattatgaccctgagagctctcgtcagctgatg
tgtgacaaatgtcctcctggcaccttcctgaaacagccctgcacggcaaggcggaagacc
gtgtgtgccccttgtcctgaccactactacacggacacctggcacaccagtgacgagtgt
ctgtactgcagcccagtgtgcaaggaactgcagtatgtaaagcaggagtgcagtcgcacc
cataaccgcgtgtgtgaatgtgaggaggggcgctatctggagctggagttctgcttgaag
cacaggagctgtccccctgggttcggagtgctacacccgggaaccccggagcgaaataca
gtttgcaaaagatgtccagatgggttcttctcgaatgagacatcatccaaagcgccctgt
agaaaacacacgaattgcagtgcatttgggctcctgctaactcagaaaggaaatgcaacg
catgacaatatatgttctggtagcagcgaatcatcgactcacaaatgcggaatagacatg
accctgtgtgaggaggcgttcttcaggtttgctgttcctacaaagcttaccccgaactgg
ctcagtgtcctggtagacaatctgcctggcaccaaagtaaatgcagagagcatagagagg
ataaaacagcgacacaactcacgagaacagactttccagctgctgaagttatggaagcat
caaaacaaagaccaagatatggtcaagaagatcatccaagacattgacctctgtgaaaac
agcgtgcggaggcacattggacacctgaacctcacctttgagcagcttctaaagttgatg
gaaagcttgccggggaagaaagtgacgaccgaagacgttgagaaaacagtgaagacgtgc
aaatcaagtgagcaactcctgaagctgctcagcctgtggaggataaaaaatggcgaccag
gacacgcgcaagggcctgctgcacgccctaaagcacttgaagacgtaccacttccccaag
actgtcattcagagtctcaagaagaccatccggttccttcacagcttcaccatgtacagg
ttatatcggaagctgtttttagaaatgataggaaaccaggtccagtcattaaagataagc
tgcttataa

DBGET integrated database retrieval system