KEGG   Bos taurus (cow): 524352
Entry
524352            CDS       T01008                                 
Symbol
ARHGEF7
Name
(RefSeq) rho guanine nucleotide exchange factor 7
  KO
K13710  Rho guanine nucleotide exchange factor 7
Organism
bta  Bos taurus (cow)
Pathway
bta04810  Regulation of actin cytoskeleton
bta05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    524352 (ARHGEF7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    524352 (ARHGEF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    524352 (ARHGEF7)
Membrane trafficking [BR:bta04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    524352 (ARHGEF7)
SSDB
Motif
Pfam: RhoGEF67_u2 RhoGEF SH3_2 SH3_9 SH3_1 RhoGEF67_u1 PH CH ECH_2
Other DBs
NCBI-GeneID: 524352
NCBI-ProteinID: NP_001280025
BGD-bta: BT13787
Ensembl: ENSBTAG00000020726
VGNC: 26121
UniProt: A0A3Q1M662
Position
12:85435098..85537675
AA seq 753 aa
MNSAEQTVTWLITLGVLESPKKTISDPEGFLQASLKDGVVLCRLLERLLPGTIEKTFDAN
DLYQGQNFNKVLSSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGPQPAHGRTSQLF
QGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFAKGDVIHVTRVEEGGWWEGTHNGRT
GWFPSNYVREVKPSEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETENEYSKEL
QTVLSTYLRPLQTSEKLSSANTSHLMGNLEEICSFQQMLVQSLEECTKMPEAQQRVGGCF
LSLMPQMKTLYLTYCANHPSAVSVLTEHSEELGEFMELKGASSPGILVLTTGLSKPFMRL
DKYPALLKELERHMEDYHPDRQDIQKSMTAFKNLSAQCQEVRKRKELELQILTEAIRSWE
GEDIKTLGSVLYMSQVLIQCAGSEEKNERYLLLFPNILLMLSASSRMSGFIYQGKLPTTG
MTITKLEDSENHRNAFEISGSMIERILVSCSNQQDLHEWVDRLQKQTKAASAGNPSSKPH
SVPSHTLPSHSITPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPW
SLSCLRPAPPLRPSAALCYKEDLSKSPKTMKKLLPKRKPERKPSDEEFALRKSTAALEED
AQILKVIEAYCTSAKTRQTLNSTWQGTDLMHNHVLADDDQSSLDSLGRRSSLSRVEPSDF
SEDSDYDSIWTAHSYRMGSTSRKSCCSYISHQN
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgaattccgccgagcagaccgttacgtggctcattaccttgggcgtgctggagtcgccc
aagaaaaccatctcggacccagagggcttcctgcaggcgtctctgaaggatggggtggtc
ctctgcaggctgctggagcgcctgctgcccggcaccatcgagaaaacgtttgatgcaaac
gatttgtatcaggggcagaatttcaacaaggtcctcagctccctagtgacgctgaataaa
gtaacagcagacatcggcctggggagtgactccgtgtgcgcccggccctcctcacaccgg
atcaagtcctttgactccctgggaccacagcctgcgcacggccggacttcacagttgttc
cagggccagtaccgcagtttggacatgaccgacaacagcaacaatcagctggtcgtcaga
gccaagtttaacttccagcagacgaatgaagacgagctgtccttcgcaaaaggcgacgtc
atccacgtgacgcgggtggaggaggggggctggtgggagggcacgcacaacggcaggacc
ggctggttccccagcaactacgtgcgcgaggtcaagcccagcgaaaagcccgtgtcgccc
aagtccggaaccttgaagagccctcccaaagggttcgatacgaccgccattaacaagagc
tactacaatgtggtgctacagaatattttggaaacagaaaatgaatattctaaagaactt
cagactgtgctttcaacctatctgcggcccctgcagaccagcgagaagttgagttcagca
aacacatcacatttaatgggaaatctagaagaaatatgttctttccagcaaatgcttgta
cagtctttagaagaatgcaccaagatgccggaggcccagcagagggtcgggggctgcttc
ctcagcctgatgccgcagatgaagaccctgtacctgacatactgtgccaaccacccgtcg
gcggtcagcgtcctcacggagcacagtgaggagctgggagagttcatggagctgaagggc
gccagcagcccggggattctcgtgctgaccaccggcctcagcaagccgttcatgcgcctg
gacaagtaccccgcgctgctcaaggagctggagagacacatggaggattatcacccagac
agacaagatattcagaaatccatgactgccttcaaaaacctttcagcgcagtgtcaggag
gtacggaagaggaaggagctggagctgcagatcctgacggaggccatccgcagctgggag
ggcgaggacatcaagaccctgggcagcgtcctctacatgtcgcaggtcctgatccagtgc
gccggcagtgaggaaaagaatgaaagatatcttctactctttccaaacatcttgctgatg
ctgtctgccagttctaggatgagtggcttcatatatcagggaaagctaccaacgacagga
atgacaatcacaaagcttgaggacagtgaaaaccatagaaacgcgtttgaaatatcaggg
agcatgatcgagcggatcttggtgtcctgcagcaaccagcaggacctccacgagtgggtg
gaccgcctgcagaagcagacgaaggccgcctcggcggggaaccccagcagcaagcctcac
tcggtgccgtcacacaccctcccctcccactccatcaccccgtccagcaagcatgcggac
agcaagcccgcgccactgacacccgcctaccacacgctgccccacccctcccaccatggc
actccacacaccaccatcaactgggggcccctggagcctccgaagacccccaagccctgg
agcctgagctgcctgcgacctgcaccccccctgcggccctcggctgccctctgctacaag
gaggacctgagcaagagtcccaagaccatgaagaagctgctgcccaagcgcaagccggag
aggaagccctcggacgaggagttcgcgctgagaaaaagcacggctgcgctggaggaggat
gcccagatcctgaaggtcatcgaggcttactgcaccagcgccaagacgcggcagacgctc
aactcaacatggcaaggcactgacctgatgcataatcacgtcttggctgacgacgaccag
tcaagtctagactccttgggtcgtcgcagcagcctctcccgtgtggagccttcagacttc
tcggaagactctgactatgacagtatatggacagcccatagttacaggatgggttctaca
tctcgtaagagctgttgctcatatatctctcaccagaactaa

DBGET integrated database retrieval system