KEGG   Bos taurus (cow): 524447
Entry
524447            CDS       T01008                                 

Gene name
LRFN2
Definition
(RefSeq) leucine-rich repeat and fibronectin type-III domain-containing protein 2 precursor
  KO
K16355  leucine-rich repeat and fibronectin type-III domain-containing protein 2
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bta04990]
    524447 (LRFN2)
Domain-containing proteins not elsewhere classified [BR:bta04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   524447 (LRFN2)
SSDB
Motif
Pfam: LRR_8 I-set Ig_3 LRR_4 ig fn3 LRR_5 LRR_9 Ig_2
Other DBs
NCBI-GeneID: 524447
NCBI-ProteinID: NP_001179524
BGD-bta: BT19883
Ensembl: ENSBTAG00000017971
VGNC: 30976
UniProt: E1BDP0
Position
23
AA seq 787 aa
METLLGGLLAFGMAFAVVDACPKYCVCQNLSESLGTLCPSKGLLFVPPDIDRRTVELRLG
GNFIIHIGRQDFANMTGLVDLTLSRNTISHIQPFSFLDLESLRSLHLDSNRLPSLGEDTL
RGLVNLQHLIVNNNQLGGIAEEAFEDFLLTLEDLDLSYNNLHGLPWGSVRRMINLHQLSL
DHNLLDHIAEGTFTDLQKLARLDLTSNRLQKLPPDPIFARSQASALTATPFAPPLSFSFG
GNPLHCNCELLWLRRLERDDDLETCGSPGGLKGRYFWHVREEEFVCEPPLITQHTHKLLV
LEGQAATLKCKAIGDPSPLIHWVAPDDRLVGNSSRTAVYDNGTLDILITTSQDSGAFTCI
AANAAGEATATVEVSIVQLPHLSNSTSRAAPPKSRLSDITGSSKTSRGGGGSGGGEPPKS
PPERAVLVSDVTTTSALVKWSVSKSAPRVKMYQLQYNCSDDEVLIYRMIPASNKAFVVNN
LVSGTGYDLCVLAMWDDTATTLTATNIVGCAQFFTKADYTQCQSMHSQILGGTMILVIGG
IIVATLLVFIVILMVRYKVCNQEGTGKPAAAVTNVHSQTNGAQPPALGSVPSGAPVPGPP
KVVVRNELMDFSASLARGSDSSSSSSLGIGEGLGRGPWRLPPPAPRPKPNLDRLMGAFAS
LDLKSQRKEELLDSRTPGGRGSGTSAKGHPSDREPLLGPPAARARSLLPLPLEGKAKRSH
SFDMGDFAAAATGGVAPGGYSPPRRVSNIWTKRSLSVNGMLLPFEESGLVGARGTFGSSE
WVMESTV
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggagaccctgcttggcggcctgctggcgtttggcatggcgtttgctgtggtcgacgcc
tgtcccaagtactgcgtctgtcagaacctgtctgagtcactggggaccctgtgcccctcc
aaggggctgctcttcgtgccgccagacattgatcggcggacagtggagctgcgtctgggt
ggcaatttcatcatccacattggccgccaggactttgccaacatgacggggctggtggac
ctgaccctgtccaggaacaccatcagtcacatccagcccttctccttcctggacctggag
agcctgcgctccctgcacctcgacagcaaccggctgcccagcctcggggaggacacgctg
cgcggcctggtcaacctgcagcatctcatcgtgaacaacaaccagctgggcggcatcgca
gaggaggcctttgaggacttcctgctgaccctggaggacttggacctctcctacaacaac
ctccacgggctgccctggggctctgtgcggcgcatgatcaacctacaccagctgagcctc
gaccacaacctgctggaccacatcgccgagggcaccttcaccgacctgcagaaactggcc
cgcctggacctcacctccaacaggctgcagaagctgcccccggaccccatcttcgcccgc
tcccaggcctcggctctgaccgccacgcccttcgccccacccctgtcctttagtttcggg
ggcaacccgctgcactgtaactgtgagcttctctggctccgcaggctggagcgggacgac
gacctagagacgtgcggctccccggggggcctcaagggccgctacttctggcacgtgcgc
gaggaggagtttgtgtgcgaaccgccgctcatcacccagcacacgcacaagctgcttgtc
ctggagggccaggcggccacgctcaagtgcaaggccatcggggaccccagccccctcatc
cactgggtggcccccgatgaccgcctggtggggaattcctccaggaccgccgtgtatgac
aatggcaccctggacatcctcatcaccacgtctcaggacagcggcgccttcacctgcatc
gctgccaacgccgctggggaggccacggccacggtggaggtctccatcgtccagctgccg
cacctcagcaacagcaccagccgggcggcaccccccaagtcccggctctcggacatcacc
ggctccagcaagaccagccgcggaggtggaggaagtgggggcggggagcctcccaaaagc
cccccggaacgggctgtgctggtgtctgacgtgaccaccacctcggccctggtcaagtgg
tcagtcagcaagtctgccccgcgggtgaaaatgtaccagctgcagtacaattgctccgac
gatgaggtactgatttacaggatgatcccagcctccaacaaggcctttgtggtcaacaac
cttgtgtccgggactggctacgacctgtgcgtgctggccatgtgggacgacacagccacc
acgctcacggccaccaacatcgtgggctgcgcccagttcttcaccaaggccgactacacg
cagtgccagtccatgcacagccagatcctgggcggcaccatgatcctggtcatcggcggc
atcatcgtggccacgctgctggtcttcatcgtcatcctcatggtgcgctacaaggtctgc
aaccaggagggcacggggaagcccgcggcggccgtcaccaacgtgcactcccagaccaac
ggggcccagccgcccgctctgggcagcgtgcccagcggggcccccgtgcccggaccgccc
aaggtggtggtgcgcaacgagctcatggacttcagtgccagcctggcccgaggcagcgac
tcctcttcctccagctccctgggcattggggaggggctgggacggggcccctggaggctc
ccaccccctgccccccgccccaagcccaaccttgaccgcctcatgggggccttcgcctcc
ttggacctcaaaagtcagagaaaggaggagctgctggactccaggactccaggcgggagg
gggtctgggacgtcggccaagggccacccctcggaccgagagccactgctggggcctccc
gcggccagggccaggagcctgctccccttgcccctggagggcaaggccaaacgcagccac
tccttcgacatgggggactttgcggccgcggctaccggaggggtcgcccccggtggctac
agccccccgcggagggtctcgaacatctggacaaagcgcagcctctctgtaaatggcatg
ctcttgcccttcgaggagagtggcctggtaggggcccgaggaactttcggcagctccgag
tgggtgatggagagcacggtgtag

DBGET integrated database retrieval system