KEGG   Bos taurus (cow): 524808
Entry
524808            CDS       T01008                                 

Gene name
HIST1H2AC
Definition
(RefSeq) histone H2A type 1-B/E
  KO
K11251  histone H2A
Organism
bta  Bos taurus (cow)
Pathway
bta04217  Necroptosis
bta04613  Neutrophil extracellular trap formation
bta05034  Alcoholism
bta05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    524808 (HIST1H2AC)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    524808 (HIST1H2AC)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    524808 (HIST1H2AC)
  09165 Substance dependence
   05034 Alcoholism
    524808 (HIST1H2AC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    524808 (HIST1H2AC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    524808 (HIST1H2AC)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    524808 (HIST1H2AC)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   524808 (HIST1H2AC)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 524808
NCBI-ProteinID: XP_015315464
BGD-bta: BT17170
Ensembl: ENSBTAG00000031768
UniProt: A0A0A0MP90
Position
23
AA seq 130 aa
MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctgggcgagggaagcaaggaggaaaaacccgagcaaaagcgaagacccgctcttcg
cgggccggacttcagttccccgtgggccgagttcaccggctgcttcgcaagggtaactac
tccgagcgggtcggtgccggggccccggtgtacctggcagcggtgttggagtacctgacc
gccgagattctagagctggcaggcaatgcggcccgggacaacaagaagacccgtattatc
ccgcgtcacctacagctggccatccgcaacgacgaggagctcaacaagctgctgggtcgt
gtgaccatcgctcagggtggtgtgctgcccaacatccaggcggtgctactgcccaagaag
accgagagccaccacaaggccaagggcaagtga

DBGET integrated database retrieval system