KEGG   Bos taurus (cow): 524870
Entry
524870            CDS       T01008                                 

Gene name
RBL1
Definition
(RefSeq) retinoblastoma-like protein 1
  KO
K04681  retinoblastoma-like protein 1
Organism
bta  Bos taurus (cow)
Pathway
bta04110  Cell cycle
bta04218  Cellular senescence
bta04350  TGF-beta signaling pathway
bta05165  Human papillomavirus infection
bta05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    524870 (RBL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    524870 (RBL1)
   04218 Cellular senescence
    524870 (RBL1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    524870 (RBL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    524870 (RBL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    524870 (RBL1)
Transcription factors [BR:bta03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    524870 (RBL1)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 ATLF
Other DBs
NCBI-GeneID: 524870
NCBI-ProteinID: NP_001179531
BGD-bta: BT18549
Ensembl: ENSBTAG00000011541
VGNC: 33781
UniProt: E1BMR3
Position
13
AA seq 1068 aa
MDEDDPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVIHWLA
CSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRE
RIERLERNFEVSTVIFKKFEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKELFNFCWTL
FVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRQELLNPSFKGLPSNFQTADFR
ASEEPPCIIPVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLCSFTDNSK
AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTGDGPLGKLTAQANVECNLQHHFE
KKTSFAPSTPLTGRRYLREKEAVITPVASATQSVSRLQSIVAGLKNAPSEQLINIFESCM
RNPMENIMKIVKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQET
RRLHGMDMSVLLEQDIFHHSLMACCLEIVLFAYSSPRTFPWIIEVLNLRPFYFYKVIEVV
IRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQASENRVPTCEEVIFPNNFETG
SGGNVQGHLPMMPMSPLMHPRVKEVRTDSGSLRKDMQPLSPISVHERYSSPTAGSAKRRL
FGEDPPKEILMDRIITEGTKLKIAPSSSITAENISISPGHSLLTMATAIVAGTTGHKVTI
PLHGIANDAGEITLIPISMNTTQESKVESPVSLTAQSLIGASPKQTHLTKAQEVHPIGIS
KPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHL
DQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVAYSKNLNG
DFEMTDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLSNQDHVMEA
PPLSPFPHIKQQPGSPRRISQQHSIYVSPHKNGSGLTPRSALLYKFNGSPSKSLKDINNM
IRQGEQRTKKRAITIDGDAESPAKRLCQENDDVLLKRLQDVVSERANH
NT seq 3207 nt   +upstreamnt  +downstreamnt
atggacgaggacgatccccacgccgagggggcggcagtggtcgccgcggccggggaagcg
ctgcaggccctgtgccaggagctgaacctggacgaggggagcgcggccgaagccctggac
gacttcactgccatccggggcaactacagcctagagggagaggttatacactggttggcg
tgttcgttgtatgttgcttgccgcaaaagcatcattcccacagttgggaagggtatcatg
gaaggaaattgcgtttcacttaccagaatactacgttcagctaaattaagtttaatacag
ttttttagtaaaatgaagaaatggatggacatgtcaaacctgccacaagaatttcgtgaa
cgtatagaaaggctagaaagaaattttgaggtgtctactgtaattttcaaaaaatttgag
ccaatttttttagatatatttcaaaatccatatgaagagccaccaaagttaccacgaagc
aggaagcagaggaggattccttgcagtgttaaagagctctttaatttctgctggacactg
tttgtttatactaagggtaattttcgtatgattggagatgatttagtaaactcttatcat
ttacttctgtgctgcttggatctgatttttgccaatgccattatgtgcccaaatagacaa
gagttgctaaatccatcatttaaaggtttaccatctaatttccaaactgctgactttcgg
gcttctgaagaacctccctgcatcattcctgtactgtgtgaactgcatgacggacttctg
gtagaagccaaaggaataaaggagcattactttaagccatatatttcaaaactctttgat
aggaagattttaaagggcgaatgccttctggacctttgcagttttactgataatagcaaa
gcagtgaacaaggagtacgaagaatatgttttaactgttggtgactttgatgagaggatc
tttttgggagcagatgcagaagaggaaattggaacccctcggaagttcactggtgacggc
ccattagggaaactgacagcacaggctaatgtggagtgtaaccttcaacatcattttgaa
aaaaaaacatcatttgcaccttctaccccactgacaggacggcgatatttaagagaaaaa
gaagcagtcattactcctgttgcttcagctacccaaagtgtgagccggctacagagtatt
gtagctggcttgaaaaatgcaccaagtgaacaacttataaatatttttgagtcttgtatg
cgtaatcctatggaaaatattatgaaaatagtgaaaggaataggagagactttctgccaa
cactatactcaatcaacagatgaacagccaggatctcacatagactttgctgtaaacaga
ctaaagcttgcagaaattttgtattataaaatattagagactgtaatggtgcaggaaaca
cgaagacttcatggaatggacatgtcagttcttttagagcaggatatatttcatcactcc
ttgatggcctgttgtttggaaatagtgctctttgcctacagctcacctcgtacttttccc
tggattattgaggttcttaatctgcgaccgttttatttttataaggttattgaggtggta
atccgctcagaggagggactttccagagacatggtaaaacacctgaacagcattgaagaa
cagattttggagagtttagcatggagtcatgattctgcgctgtgggaggctctccaggct
tctgaaaacagagttcctacctgtgaagaagttatattcccaaacaattttgaaacagga
agtggaggaaatgtacagggacatcttcccatgatgccaatgtctcctctgatgcatcca
agggtcaaagaagttcggactgacagtggaagtcttcgaaaggatatgcaaccattgtct
ccgatttctgtccatgaacgctacagttctcctactgctgggagtgctaagagaagactt
tttggggaagaccccccaaaggaaatacttatggacaggatcattacagaaggaacaaaa
ttgaaaattgctccttcttcaagcatcactgctgaaaatatatcaatttcacccgggcat
agtcttctgacaatggccacagccatagtagcagggacaacaggacataaagttacaatc
ccattgcatggtattgcaaatgatgctggagagatcacactgataccaatttccatgaat
acaactcaggagtccaaagttgagagtcctgtatcacttacagctcagtcattaattggt
gcttctccaaagcagacccatttgaccaaagcacaagaggtacatccaattggaataagc
aaaccaaagagaactgggtccttagcactgttttatagaaaggtctatcatttggcaagt
gtacgcttacgtgatttatgtttaaaactggatgtttcaaatgagttaagaaggaagata
tggacatgttttgaattcactttagttcactgtcctgatctgatgaaagacagacatttg
gatcagctcctcctttgtgccttttatatcatggcaaaggtaacaaaagaagaaagaact
tttcaagaaataatgaaaagttataggaatcagccccaagctaatagtcacgtctataga
agtgtactattgaaaagtattccaagagaagttgtggcatacagtaaaaacctgaacggt
gattttgaaatgacagattgtgacttggaagatgctacaaaaacaccggactgctccagt
ggaccagtgaaagaggagagaggtgatcttatcaaattttacaatacaatatatgtagga
agagtgaagtcattcgcattgaaatacgacttgtcaaatcaggaccatgtgatggaagct
ccgccactctccccttttccacatattaagcaacagccaggctccccacgccgcatttcc
cagcagcactccatttatgtgtccccacacaagaatgggtcgggccttacaccaaggagt
gctctgctatataaattcaacggcagcccttctaagagtttgaaagatatcaacaacatg
ataaggcaaggtgagcagagaaccaagaagcgagcaataaccatcgatggtgatgcagaa
tcacctgccaaacgcctctgtcaagaaaatgatgatgttttacttaaacgactacaggat
gttgtcagtgaaagagcaaaccactag

DBGET integrated database retrieval system