KEGG   Bos taurus (cow): 525107
Entry
525107            CDS       T01008                                 

Gene name
SYNJ2BP
Definition
(RefSeq) synaptojanin-2-binding protein
  KO
K20057  synaptojanin-2-binding protein
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    525107 (SYNJ2BP)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    525107 (SYNJ2BP)
SSDB
Motif
Pfam: PDZ PDZ_6 PDZ_2 Tricorn_PDZ
Other DBs
NCBI-GeneID: 525107
NCBI-ProteinID: NP_001030432
BGD-bta: BT21149
Ensembl: ENSBTAG00000007586
UniProt: Q3T0C9
Position
10
AA seq 145 aa
MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIFVSRIKENGAAALDGRLQ
EGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGPQGEGEPSGIPI
AMVLVPVFALTMVAAWAFMRYRQRL
NT seq 438 nt   +upstreamnt  +downstreamnt
atgaacggaagagtggattacttggttaccgaggaagagatcaatctcaccagaggaccg
tcagggctgggcttcaacatcgtcggtgggacagatcagcagtatgtctccaacgacagt
ggcatcttcgtcagccgcatcaaagagaacggggctgcggccctggatgggcggctccag
gagggtgataagatcctctcggtcaacggccaagacctaaagaacctgctgcaccaggac
gctgtggacctcttccgtaacgcgggctatgctgtgtccctgagagtgcagcacaggtta
caggtgcagaatgggcccataggacctcaaggtgaaggggagccaagtggtattcccata
gctatggtgctggtgccagtgtttgccctcaccatggtagcagcctgggccttcatgaga
taccggcaacgactttga

DBGET integrated database retrieval system