KEGG   Bos taurus (cow): 525507
Entry
525507            CDS       T01008                                 

Gene name
KCNA3
Definition
(RefSeq) potassium voltage-gated channel subfamily A member 3
  KO
K04876  potassium voltage-gated channel Shaker-related subfamily A member 3
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    525507 (KCNA3)
Ion channels [BR:bta04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   525507 (KCNA3)
SSDB
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel
Other DBs
NCBI-GeneID: 525507
NCBI-ProteinID: XP_005204275
BGD-bta: BT21880
Ensembl: ENSBTAG00000047879
VGNC: 30423
UniProt: E1B7K3
Position
3
AA seq 576 aa
MDEHLSLLRSPPQPSARQRAHPPQQPASGGGAHTLVNPGYTEPAAGSELPPDMTVVPGDH
LLEPEAADGGGDPPQGGCGGGGGCDRYEPLPPALPAAGEQDCCGERVVINISGLRFETQL
KTLCQFPETLLGDPKRRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRIRRPVNVPIDI
FSEEIRFYQLGEEAMEKFREDEGFLREEERPLPRRDFQRQVWLLFEYPESSGPARGIAIV
SVLVILISIVIFCLETLPEFRDEKYYTASPSQEQFEASSNSTSGGPTGASSFSDPFFVVE
TLCIIWFSFELLVRFFACPSKATFSRNIMNLIDIVAIIPYFITLGTELAERQGNGQQAMS
LAILRVIRLVRVFRIFKLSRHSKGLQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFA
EADDPTSGFSSIPDAFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPVPVI
VSNFNYFYHRETEGEEQAQCLHVGSCQHLSPSAEELRKARSNSTLSKSEYMVIEEGGMNH
SAFPQAPFKTGNSTATCTTNNNPNSCVNIKKIFTDV
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggacgagcacctcagcctcctgcgctcgccgccgcagccctccgcccgccagcgcgcc
caccctccgcagcagcccgcgagcggcggcggcgcccacacgctggtgaaccccggctac
accgagcccgccgcgggctccgagctgccgcccgacatgacggtggtgcccggggaccac
ctgctggagccggaggcggccgacggcggcggggacccgcctcagggtggctgcggtggc
ggcggcggctgcgaccgctacgagccgctgcctcccgcgctgccggccgccggcgagcaa
gactgctgcggggagcgagtggtcatcaacatctcggggctccgcttcgagacgcagctc
aagaccctctgccagttcccggagacgctgctgggcgaccccaagcggcgcatgaggtac
ttcgacccgctccgcaacgagtacttcttcgaccgcaaccggcccagcttcgacgccatc
ctctactactatcagtccgggggtcgaatccgccggcctgtcaatgtgcccatcgacatc
ttttccgaggagatccgcttctaccagctgggcgaggaggccatggagaagttccgcgag
gacgagggcttcctgcgggaggaagagcggcccctgccccgccgcgatttccagcgccag
gtgtggctgctcttcgagtacccggagagctccgggccggcccggggcatcgccatcgtg
tccgtgctcgtcatcctcatctccatcgtcatcttctgcctggagacgctgcccgagttc
cgcgacgagaagtactacaccgcgtcgccgtcgcaggagcagttcgaagcgtccagtaac
agcacgtcggggggccccacgggagcctccagcttctctgatcccttcttcgtggtggag
accttgtgcatcatctggttctcctttgagctgctggtgcggttcttcgcttgccccagc
aaagctaccttctcgcgaaatatcatgaacctgatagacatcgtggccatcatcccttat
ttcatcactctaggcaccgagctagctgagcgacagggcaatggacagcaagccatgtcc
ctggccatcctgagagtcatccgcctggtgagggtcttccgcatcttcaagctctcccgc
cactcaaaggggctgcagatcctggggcagacgctaaaggcttccatgcgggagctgggg
ctgctcatcttcttcctctttattggtgtcatcctcttctccagcgctgtctactttgcc
gaggcggacgaccccacttcaggttttagcagtatcccggatgccttctggtgggctgtg
gtaaccatgacaacagtaggttatggtgacatgcacccagtgaccatagggggcaagatt
gtggggtccctgtgtgccatcgcaggtgtcttgaccattgctttgccagtccctgtaatt
gtttccaacttcaattacttctaccaccgggagacagaaggggaagagcaagcccagtgc
ttgcacgtgggaagttgccagcatctctccccttcagctgaggagctccggaaagcaagg
agtaactccactctgagtaagtcggagtatatggtgatcgaagaggggggtatgaaccat
agcgctttcccccaggcacccttcaaaacgggcaattccacggccacctgcaccacgaac
aataatcccaactcctgtgtcaacatcaaaaagatatttaccgatgtttaa

DBGET integrated database retrieval system