KEGG   Bos taurus (cow): 525738
Entry
525738            CDS       T01008                                 

Gene name
ADPRH
Definition
(RefSeq) [Protein ADP-ribosylarginine] hydrolase
  KO
K01245  ADP-ribosylarginine hydrolase [EC:3.2.2.19]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    525738 (ADPRH)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.19  [protein ADP-ribosylarginine] hydrolase
     525738 (ADPRH)
SSDB
Motif
Pfam: ADP_ribosyl_GH c-SKI_SMAD_bind
Other DBs
NCBI-GeneID: 525738
NCBI-ProteinID: NP_001033643
BGD-bta: BT23523
Ensembl: ENSBTAG00000009391
VGNC: 25690
UniProt: Q32KR8
Position
1
AA seq 353 aa
MCGALMERYVAAMVLSAAGDALGYFNGKWEFLQNGEKIHRQLAQLGGLDAIDVERWRVSD
DTVMHLATAEALLEAGKVSDLTHLYSLLAKHYQDCMGDMDGRAPGGASVQNAMLLEPDKA
DGWRIPFNSHEGGCGAAMRAMCIGLRFPHSSQLDSLIQVSIESGRMTHHHPTGYLGALVS
ALFTAYAVNGKPPQQWGRGLMEVLPEAKKYIVQSGFFVEQNLQHWSYFQDQWEKYLKLRG
IWDGKSAPTFPKPFDVKERDQFYSSVSYSGWGGSSGHDAPMIAYDAILAAGDSWKELAHR
AFFHGGDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLR
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgtgtggggccctgatggagaggtatgtggcagccatggtgctgagtgcagctggagat
gccttgggatacttcaatggaaagtgggagttcctccagaatggggagaaaattcacagg
cagctggcccagcttggtggcttggatgccatagatgtggagaggtggagagtcagcgat
gacaccgtgatgcacctggccacagcagaagcactcctggaagctggcaaagtctcagac
ttgactcacttgtattccctccttgctaagcattaccaggactgcatgggagacatggat
ggccgggcaccagggggtgcctcagtgcagaacgccatgctgctggagccagacaaagcc
gatggctggaggattccctttaacagtcatgagggtggctgcggggccgccatgagggcc
atgtgcattggtctccggttccctcacagcagtcagctggactcactgatccaggtgagc
atcgagagcggccggatgacccatcaccatcccacaggctacctgggagcccttgtgtct
gctctttttacagcctatgctgtgaacggcaagcctccccagcagtggggaagaggactg
atggaggtacttccggaagctaaaaagtacattgtccaatcaggcttctttgtggagcag
aatcttcaacactggtcttacttccaagaccagtgggaaaagtacctaaaactcagagga
atttgggatggcaaatcagcccctaccttccccaagccctttgatgtgaaggaaagggat
cagttctacagttctgtgagctactctggctggggcggcagcagtggacacgatgccccc
atgattgcctatgatgccatcctggctgcaggagactcctggaaggagcttgcccaccga
gcatttttccacggtggagacagtgattctaccgctgcaattgctggctgttggtgggga
gtgatgtatggttttaaaggagtaagtccctccaactatgagaagctagaatacagaaac
cggctggaagagacagctagggctttgtattctcttaggtaa

DBGET integrated database retrieval system