KEGG   Bos taurus (cow): 525795
Entry
525795            CDS       T01008                                 
Symbol
AGRN
Name
(RefSeq) agrin isoform X2
  KO
K06254  agrin
Organism
bta  Bos taurus (cow)
Pathway
bta04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    525795 (AGRN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:bta00535]
    525795 (AGRN)
Proteoglycans [BR:bta00535]
 Extracellular matrix (ECM) proteoglycans
  Basement membrane proteoglycans
   525795 (AGRN)
SSDB
Motif
Pfam: Laminin_G_1 Kazal_2 Laminin_G_2 Kazal_1 NtA Laminin_EGF SEA EGF Laminin_G_3 hEGF
Other DBs
NCBI-GeneID: 525795
NCBI-ProteinID: XP_002694239
BGD-bta: BT28664
Ensembl: ENSBTAG00000013191
VGNC: 25742
Position
16:complement(51422630..51461933)
AA seq 2043 aa
MASFRPFSRALLQPLLLLLVVAVRALPSADGTCPERALERREEEANVVLTGTVEEILNVD
PVQHTYSCKVRVWRYLKGKDVVAQESLLDGGNKVVIGGFGDPLICDNQVSTGDTRIFFVN
PAPPYLWPAHKNELMLNSSLMRITLRNLEEVEHCVEDKPGTHFTPVPPTPPDACRGMLCG
FGAVCEPSADEPGRASCVCKKSSCPSVVAPVCGSDASTYSNECELQRAQCSQQRRIRLLR
RGPCGTRDPCSNVTCSFGSTCVPSADGLTATCLCPATCLGAPEGPVCGSDGSDYPSECQL
LRHACAHQENIFKKFDGPCDPCQGFLSDLSRTCRVNPRTRRPEMLLRPESCPPRGTPVCG
DDGVTYDNDCVMGRTGAAQGILLQKVRSGQCQPRDQCPEPCRFNAVCLSRRGRPRCSCDR
VVCDGAYRPVCAHDGHTYDNDCWRQQAECQQQRSIPMKHQGPCDQSPSPCRGVQCPFGAM
CAVKNGEAECACPKACSGVYDPVCGSDGITYGSACELEATACALGREIRVARRGPCDRCG
QCRFGALCEAETGRCVCPSECVASAQPVCGSDGRTYASECELHVHACTHQISLHVASAGP
CQTCGDTVCAFGAVCSAGQCVCPRCERPPPGPVCGSDGVTYGSSCELREAACQQQTQIEE
AWAGPCEQAECGSGGSGSGEDGECEPELCRQRGGIWDEDSEDGPCVCGFSCQGVLRSPVC
GSDGVTYRTECELKKARCESQPELYVVAQGACRGPTLAPLPPAIPLHCAQTPYGCCQDNI
TVAQGVGLAGCPSSCQCNPHGSYGGTCDPVTGQCSCRPGVGGLKCDRCEPGFWNFRGIVT
DGRSGCTPCSCDPRGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCETDSSPP
KTCAEMLCEFGASCVEEAGSAHCVCPTPTCPGADATKVCGSDGVTYGNECQLRTIACRQG
LEISIQSFGPCQEGITSGPRVTSASVAPSALDLNKAPLPPPSALPLAPSSTRHSQPTSRA
SSQPWTMASIPRTTARPVLTMPPVAPSPAASLVTSAFGESGSADGSGDEELSGDLEASGA
GSGGLESPERDSAGTPGLPMERASCYNSPMGCCSDGKTPSLDAEGSNCPATKVFQGVLEL
EGVEGQELFYTPEMADPKSELFGETARSIESALDDLFRNSDVKKDFRSVRLRDLGPGSSV
RAIVEVHFDPTTAFRASDVGRALLRQLQASRRRSLGVRRPLQEHVRFMDFDWFPAFFTGA
TPAAATARATTVARLPPSAATPRAHFPSHTSRPVSRTTPPATTRQPPTTAPSRVPGRRPL
PPGTQQPRRPCDSQPCLHGGTCQDQGSGADFTCSCPAGTGGAVCEKALHPSVPAFGGHSF
LAFPTLRAYHTLRLALEFRALEPQGLLLYNGNARGKDFLGLVLLGGRVQFRFDTGSGPAV
LTSSVPVQPGRWHHLELSRHWRQGTLSVDGETPVLGQSPSGTDGLNLDTDLFVGGVPEDQ
ASTVLERTSVSIGLRGCIRLLDVNNQRLELSSWPESATRSSGVGKCGDHPCLPSPCLGGA
PCQALEAGRFHCQCPPGRFGPTCADEKDPCQPNPCHGAAPCRVLPQGEAKCECPHGREGS
LCQTVSEPEDNQPFLADFSSFSYLELKGLHTFERDLGEKMALEVVFLARSPSGLLLYNGQ
KTDGKGDFVSLALHNGLLEFRYDLGKGAAVIRSKEPVALGAWTRVSLERNGRKGAMRVGD
GPRVLGESPVPHTVLNLKEPLFVGGAPDFSKLARAAAVSSGFDGAIQLVSLNGRQLLTRE
NVVRAVDVSSFADHPCTQAEGQPCLHGASCLPREASYECLCPAGFSGLHCEKGLIEKSAG
DLDALAFDGRTYIEYLNAVTESEKALQSNHFELSLRTEATQGLVLWSGKATERADYIALA
IVDGRLQLAYDLGSQPVVLRSTVPVNTNRWLRVRAHRKQREGSLQVGNEAPVTGSSPLGA
TQLDTDGALWLGGLEKLPTGQALPKAYGTGFVGCLRDVVVGQRPVHLLEDAITKPELRPC
PAL
NT seq 6132 nt   +upstreamnt  +downstreamnt
atggccagctttcggccgttcagccgggccctgctgcagcctttgctgctgctcctggtg
gtggccgtgcgcgccctgcccagcgccgacgggacgtgccccgaacgcgcgctggagcgg
cgcgaggaggaggcgaacgtggtgctcaccggcaccgtggaggagatcctcaacgtggac
ccggtgcagcacacatactcgtgcaaggttcgggtctggcggtacctgaagggcaaagat
gtggtggcccaggaaagcctgctggacggaggcaacaaagtggtgattggcggcttcgga
gaccccctcatctgtgacaaccaggtgtccactggagacaccaggatcttctttgtgaac
cctgccccgccatacctgtggcccgcccacaagaatgagctgatgctaaactccagcctc
atgcgcatcaccctgcggaacctggaggaggtcgagcactgtgtggaagacaaacctggg
acccacttcacgccagtgcccccaacacctccggatgcgtgccgaggaatgctgtgtggc
ttcggcgctgtctgcgagcccagcgcagacgagccgggccgagcctcctgcgtgtgcaag
aagagctcctgccccagcgtggtggcgcccgtgtgcggctcggatgcctccacctacagc
aacgagtgcgagctgcagcgggcgcagtgcagccagcagaggcgcatccgtttgctgcgc
cgcgggccctgcgggacccgggacccctgctccaatgtcacctgcagctttggcagcacc
tgtgtgccttctgcggatggactgacagccacgtgcctgtgccctgccacgtgcctgggg
gccccggaaggccctgtgtgcggcagcgacggcagtgactaccccagcgagtgccagctc
ttacgccacgcctgtgcccaccaagagaacatcttcaagaagttcgacggtccttgcgac
ccctgccagggcttcctcagtgacctgagccgtacctgccgtgtgaacccacgcacgcgg
cggccggagatgctcctgcgaccagagagctgccctccccgtgggacacctgtgtgtggg
gacgacggggttacttacgataatgactgcgtcatgggccgaacaggggctgctcaaggc
atcctcctgcagaaagtgcgctctggccagtgccagcctcgagaccagtgcccggagccg
tgcagattcaatgccgtctgcctgtcccgccgaggccgcccccgctgttcctgcgaccgc
gtcgtctgtgacggggcctacagacctgtgtgtgcccatgacgggcacacgtatgacaat
gactgctggcgccagcaggccgagtgtcagcagcagcgtagcattcccatgaagcaccag
ggcccgtgtgaccagtccccatccccatgccgtggggtgcagtgtccatttggggcaatg
tgtgctgtgaagaatggggaagccgaatgtgcgtgtccgaaggcgtgttcaggcgtctat
gaccctgtgtgtggcagtgatggcatcacatatggcagtgcgtgtgaactggaagccaca
gcctgtgcccttgggcgggagatccgagtggctcgccgaggaccctgtgaccgctgtggg
cagtgccgctttggagccctgtgtgaagctgagaccgggcgctgtgtgtgcccctccgaa
tgtgtggcctcagcccagcctgtgtgtggctctgatgggcgcacgtatgccagtgaatgt
gaactacacgtccacgcctgcacacaccagatcagtctgcacgtggcctcggctggtcct
tgccagacctgtggagacacagtgtgtgcctttggggctgtgtgctcagcggggcagtgc
gtgtgtccccggtgtgagcgccctccacccggccccgtgtgtggcagcgatggcgtgacc
tacggcagttcatgcgagctccgtgaggctgcctgtcagcagcaaacacagatcgaggag
gcctgggcggggccgtgtgagcaagctgagtgtggctccggaggctcgggctcgggagag
gacggcgagtgtgagcctgagctgtgccggcagcgaggtggcatctgggatgaggactcg
gaggacgggccatgcgtctgcggcttcagctgccagggcgtcctgaggagcccggtgtgt
ggctcggatggagtcacctaccgcaccgaatgtgagctgaagaaggccaggtgtgaatca
cagccagagctgtatgtcgtggcccagggagcctgccgtggccccactttggccccgttg
ccacctgcgattcccctgcactgtgctcagaccccctacggttgctgccaggacaacatc
actgttgcccagggtgttggcctggctggctgccccagctcatgccagtgtaacccacac
ggctcctacggcggcacctgtgaccctgtcacaggtcagtgctcctgccgcccaggtgtg
gggggcctcaagtgtgaccgctgtgagcctggcttctggaacttccgtggtatcgtcact
gacggccggagcggctgtaccccctgcagctgtgacccccggggtgccgtgcgggacgac
tgtgagcagatgactgggctatgttcctgtaagcctggggtggccgggcccaagtgtggg
cagtgtccagatggccgtgccctgggccctgctggctgtgaaacagactcttcgccaccc
aagacctgtgctgagatgctttgtgagtttggggcatcctgtgtggaggaggctggctct
gcccactgcgtgtgcccaacacccacctgtccaggggccgatgctaccaaggtctgcggg
tcagatggagtcacttatggcaatgagtgccagctgaggaccatcgcctgccgccagggc
ttggagatctctatccaaagcttcggcccctgccaggaaggcatcacttctggtccccgt
gtgacatccgcatctgtggctccctcagcacttgacctgaacaaggcaccattgccgccc
cccagcgccttgcccctggctcccagcagtacccgccacagccagcccacttctcgagcc
tcatcacaaccttggaccatggccagcatccccaggaccactgcaaggccagtgctgacc
atgcctcccgtggccccctccccggcagccagcctcgtcacctctgccttcggcgaatct
ggcagcgctgatgggagtggtgacgaggagctgagtggtgacttggaggccagtggggct
ggctcaggaggacttgagtccccggaaagagacagtgctgggacccctgggctacccatg
gaaagggcttcctgctacaactcgcctatgggctgctgctcagatggcaagacaccctcc
ctggacgcagagggctctaactgtcctgccaccaaggtgttccagggtgtgctggagctt
gagggggtcgaggggcaagaactgttctacacgccggagatggcagaccccaagtctgag
ctgtttggggagactgccaggagcattgagagcgcactggatgacctcttccggaactcg
gacgttaagaaggacttccgaagtgtccgcctacgggacttggggccaggcagctcggtc
cgggccattgtggaagtgcactttgatcccaccacagccttcagggcgtctgacgtgggc
cgggccctgctccggcagctccaggcgtccaggcgcaggtccctgggcgtgaggcggcct
ctgcaagaacatgtgcggttcatggacttcgactggtttcctgcattcttcacgggagcc
accccagctgcagccacggccagagccaccacggtggcccgcctgccaccttcagctgca
acccctcgggcccactttcccagtcacacaagccggcccgtcagcaggaccacacctccc
gcgaccacgcgccagccccccaccactgcccctagtcgtgtgcctggacgccgtcccctg
cccccaggcacccagcagccccgaaggccctgtgattcccagccctgcctccatgggggg
acctgccaggaccagggctcgggtgcagacttcacctgcagctgcccagcaggcacgggg
ggtgccgtctgtgagaaggccctgcacccctccgtgccagcctttgggggccactccttc
ctggcctttcccaccctccgtgcctaccacaccctgcgcctggcgctcgagttccgggcg
ctggagccccaggggctgctgctctacaacggcaatgcccggggcaaggacttcctggga
ctggtgctgctgggaggccgtgtgcagttcaggttcgacacaggctcagggcccgcggtg
ctgaccagctccgtgcccgtgcagcccggccgctggcatcacctggagctgtctcggcac
tggcgccaaggcactctctccgtggacggtgagactcctgttctgggccagagccccagt
ggcactgacggtctcaacctggacactgatcttttcgtgggtggcgtccctgaggatcag
gcttccacggtgctagagcggacctctgtcagcatcggtcttaggggttgtatccgcttg
ctggatgtcaacaatcagcggctggagctgagcagctggccagagtctgcgactcgaagc
tccggagtgggcaagtgcggggaccacccctgtctgcctagcccctgcctcggaggggcc
ccgtgccaggccctggaggcaggcaggttccactgtcagtgcccacctggccgctttggc
ccaacctgtgccgacgagaaggacccttgtcagccgaacccctgccatggagcagccccc
tgccgcgtgctgccccagggagaggccaagtgcgagtgcccccatggccgggagggcagc
ctctgccagacagtctcagagccggaggacaaccagccgttcctggctgatttcagcagc
ttctcctacctggaactgaaaggcctgcacacctttgagcgggacctgggggagaagatg
gcactggaggtggtgttcctggctcggagccccagcggcctgctcctctataatggacag
aagacagatggcaagggcgactttgtgtccctggcgctgcacaatggcctcctggagttc
cgctacgatctgggcaagggggcagcggtcatcaggagcaaggagccagtggccctgggt
gcctggaccagggtctccctggagcgaaatggacgcaaaggagccatgcgggttggtgat
gggcctcgcgtgctgggggagtccccggtgccacacaccgttctcaacctaaaggagccg
ctctttgttgggggggcccctgacttcagcaagctggcccgagcagctgctgtgtcctct
ggctttgatggagccatccagctggtctccctgaatggccgccaactgctgacccgtgag
aacgtggtccgggccgtggacgtctcgtcctttgcagaccacccttgtacccaggctgag
ggtcagccttgcctccatggggcttcctgtctcccccgcgaggcctcctatgagtgcctg
tgtcctgcaggcttctcagggctgcactgtgagaagggcttgattgagaagtcagctggg
gacctggacgcactggcctttgatggacggacctacatcgagtacctcaacgctgtgacc
gagagtgagaaggcactccagagcaaccactttgagctgagcctgcgcactgaggccaca
caggggctggtgctgtggagtggcaaggccacggagcgggctgactacatcgcactggcc
atcgtggacgggcgcctgcaactggcttatgacctgggctcccagcccgtggtgttgcgc
tccaccgtaccagtgaataccaaccgctggttgcgggtcagggcacacaggaaacagagg
gaaggttcccttcaggtgggcaacgaggcccctgtgactggctcctccccactgggtgcc
acgcagctggacacagatggagccctgtggctgggtggcctggagaagctgcccacaggc
caggccctgcccaaagcctatggcacaggcttcgtgggctgcctgcgggacgtggtcgtg
ggccagcgcccggtgcacctgctggaggacgccatcaccaagccagagcttcggccctgc
cctgccctgtga

DBGET integrated database retrieval system