KEGG   Bos taurus (cow): 525988Help
Entry
525988            CDS       T01008                                 

Gene name
GPX5
Definition
(RefSeq) epididymal secretory glutathione peroxidase precursor
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bta  Bos taurus (cow)
Pathway
bta00480  Glutathione metabolism
bta00590  Arachidonic acid metabolism
bta01100  Metabolic pathways
bta04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    525988 (GPX5)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    525988 (GPX5)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    525988 (GPX5)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     525988 (GPX5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 525988
NCBI-ProteinID: NP_001020506
BGD-bta: BT10107
Ensembl: ENSBTAG00000021987
VGNC: 29620
UniProt: A0A3Q1M7E3 Q4TUB7
Position
1
AA seq 219 aa AA seqDB search
MTIQLRASCLFLFFLAGFVQTNSNLEKMDCYKDVKGTIYDYDAFTLNGKEHIQFKQYAGK
HVLFVNVATYCGLTAQYPELNALQEELKPFGLVVLGFPCNQFGKQEPGENSEILPGLKYV
RPGGGYVPNFQLFEKGDVNGETEQKVFTFLKQSCPHPSEIMGSIKHISWEPIMVRDIRWN
FEKFLVGPDGIPVMRWFHRTPVSTVKTDILAYMKQFKTK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgactatacagttaagggcctcttgtctttttctctttttcctagccggctttgtgcag
acaaattccaatctagagaagatggattgctacaaagatgtgaaaggcactatctatgat
tatgatgctttcactcttaatggaaaggaacacattcagttcaagcaatatgcgggcaag
catgtcctttttgtcaatgtggccacctattgtggtctgacagctcaatatcctgaactg
aatgcactacaggaggagctgaagccctttggcctagttgtgttgggatttccctgtaac
caatttggaaagcaagaaccaggagaaaactcagaaattcttccaggactgaagtatgtc
cgtccaggaggaggatacgtacctaatttccagctgtttgagaaaggggatgtgaatggt
gaaacagagcagaaagtcttcaccttcttaaagcaatcctgtcctcacccttctgagatt
atgggctcaatcaaacatatatcctgggaacccatcatggtccgtgacatccgctggaat
tttgaaaagttcctagtgggacctgatggcatccctgtcatgcgctggtttcatcggact
ccagtcagtacagtcaagacagatatcctggcatacatgaaacagttcaaaaccaaataa

DBGET integrated database retrieval system