KEGG   Bos taurus (cow): 526343Help
Entry
526343            CDS       T01008                                 

Gene name
UTP15
Definition
(RefSeq) U3 small nucleolar RNA-associated protein 15 homolog
  KO
K14549  U3 small nucleolar RNA-associated protein 15
Organism
bta  Bos taurus (cow)
Pathway
bta03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    526343 (UTP15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bta03009]
    526343 (UTP15)
Ribosome biogenesis [BR:bta03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    526343 (UTP15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UTP15_C WD40 ANAPC4_WD40 BBS2_Mid Abhydro_lipase
Motif
Other DBs
NCBI-GeneID: 526343
NCBI-ProteinID: NP_001094598
BGD-bta: BT17370
Ensembl: ENSBTAG00000006843
VGNC: 36742
UniProt: A7MB12
Position
20
AA seq 519 aa AA seqDB search
MAGYKPVSIQTYPVLGEKITQDTLYWNNYKTPVQIKEFGAVSKVDFSPQPPYNYAVTASS
RIHIYGRYSQEPIKTFSRFKDTAYCATFRQDGRLLVAGSEDGGVQLFDISGRAPLRQFEG
HTKAVHSVDFTADKYHVVSGADDYTVKLWDIPNSKEILTFKEHSDYVRCGCASKLNTDLF
VTGSYDHTVKMFDARTNQSVISVEHGQPVESVLLFPSGGLLVSAGGRYVKVWDMLKGGQL
LVSLKNHHKTVTCLCLSSSGQRLLSGSLDRKVKVYSTTSYKVVHSFDYTASILSLALAHE
DETIVVGMTNGILSVKHRKSEAKKDSVPRRRRPAYRTFIKGKNYMKQQDDILINRPSKKH
LELYDRDLKNFRISKALDRVLEPTCTIKTPEVTVSIIKELNRRGVLANALAGRDEKEISR
VLNFLIRNLSQPRFAPVLINAAEIIIDIYLPVIGQSPVVDKKFLILQGLVEKEIDYQREL
LETLGMMDMLFATMTRKESTSVLQHNTSDGFLENNKIES
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggctggttataagcctgtatcaatccagacatatcctgtacttggtgaaaaaatcacc
caagatacactgtactggaacaactataagacacctgttcagatcaaggagtttggtgca
gtgtcaaaagtggacttttctccccagcctccatataactacgcagtcacagcttcttca
aggattcacatttatggccgatactcccaagaacctataaaaaccttttcccgatttaaa
gacacagcatactgtgctacttttcgacaggatggtagactccttgtggctggcagtgaa
gatggtggggttcagctttttgatataagcgggagggctcccctcaggcagtttgaaggc
catactaaagcagttcattcagtagattttacagctgacaaatatcatgtggtttctggg
gctgatgattatacagttaaattatgggatattccaaactccaaagaaattctgacattc
aaagaacattctgattatgtgaggtgtggatgtgctagcaaactgaacacagatctcttt
gtcacagggtcgtatgatcatactgtgaagatgtttgatgcacgaacaaaccagagtgtt
atctctgttgagcatggacagccagtggagagtgtcctgctttttccctctggaggtctt
ctggtatcagcaggaggtcggtatgttaaagtctgggacatgctaaaaggaggacagttg
ctagtgtctttgaaaaatcatcataaaactgtgacatgtttatgtctcagcagctctgga
cagaggttactctctggctcactggataggaaggtgaaagtatatagcacaacttcctac
aaagtagtccacagttttgattatacagcttcaattttgagtcttgcacttgcacatgaa
gatgagacaatagttgtaggaatgaccaatggaatactgagtgttaaacatcggaaatct
gaagcaaagaaggattcggtgcccaggagaagaaggcctgcatatcgaacttttattaag
ggaaaaaattatatgaaacaacaggatgacattttgatcaacagaccatcaaagaaacat
ctagaattgtatgacagggatctgaaaaacttccggatctctaaggcacttgacagagtc
cttgagcctacttgtacaataaagacacccgaggttacagtttccatcataaaggagcta
aatcgaagaggagtccttgcaaatgcccttgcaggtcgagatgaaaaggaaatcagtcgt
gttcttaattttttgataaggaatctgtctcagccaagatttgcccctgttttgattaat
gctgctgaaataattattgatatatatctacctgtgattggtcaatcacctgtagttgat
aaaaagtttttgatacttcaaggacttgtagaaaaagagattgattaccagcgagaacta
ctggaaaccttgggcatgatggatatgctttttgctaccatgacaaggaaagaaagcact
tctgtgttgcagcataatacatctgatggatttctagagaacaataagattgaatcatag

DBGET integrated database retrieval system