KEGG   Bos taurus (cow): 526364Help
Entry
526364            CDS       T01008                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
bta  Bos taurus (cow)
Pathway
bta00564  Glycerophospholipid metabolism
bta00565  Ether lipid metabolism
bta00590  Arachidonic acid metabolism
bta00591  Linoleic acid metabolism
bta00592  alpha-Linolenic acid metabolism
bta01100  Metabolic pathways
bta04010  MAPK signaling pathway
bta04014  Ras signaling pathway
bta04072  Phospholipase D signaling pathway
bta04217  Necroptosis
bta04270  Vascular smooth muscle contraction
bta04370  VEGF signaling pathway
bta04611  Platelet activation
bta04664  Fc epsilon RI signaling pathway
bta04666  Fc gamma R-mediated phagocytosis
bta04724  Glutamatergic synapse
bta04726  Serotonergic synapse
bta04730  Long-term depression
bta04750  Inflammatory mediator regulation of TRP channels
bta04912  GnRH signaling pathway
bta04913  Ovarian steroidogenesis
bta04921  Oxytocin signaling pathway
bta05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    526364 (PLA2G4E)
   00565 Ether lipid metabolism
    526364 (PLA2G4E)
   00590 Arachidonic acid metabolism
    526364 (PLA2G4E)
   00591 Linoleic acid metabolism
    526364 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    526364 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    526364 (PLA2G4E)
   04010 MAPK signaling pathway
    526364 (PLA2G4E)
   04370 VEGF signaling pathway
    526364 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    526364 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    526364 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    526364 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    526364 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    526364 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    526364 (PLA2G4E)
   04913 Ovarian steroidogenesis
    526364 (PLA2G4E)
   04921 Oxytocin signaling pathway
    526364 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    526364 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    526364 (PLA2G4E)
   04726 Serotonergic synapse
    526364 (PLA2G4E)
   04730 Long-term depression
    526364 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    526364 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    526364 (PLA2G4E)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     526364 (PLA2G4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2 CEP76-C2
Motif
Other DBs
NCBI-GeneID: 526364
NCBI-ProteinID: XP_024853950
BGD-bta: BT17067
Position
10
AA seq 860 aa AA seqDB search
MTLQTSEGHPGLGTDVFVPQSLQWDEEGSMAGRSVCESEQIQVLETPHLTSLLPVAPDGS
QEGLSPCHLLTVRVIRMKNVRQADVVSLTDCFVSLWLPTASEKRLRTRTISNCRNPEWNE
TFSFQIQSQVKNVLELSVCDEDTVTPDDHLLTVLYDLTKLCFRKKTHVKFPLNTEGMEEL
EVEFLLEESPSPPESLITNGVLVSRQMSCLEVCAESRRPKKRKKKDLLVTVTESFEHTQH
ISPCLESCCSNLACFQYPKYFQPEVHVELPKSPWICELCCCARQKGPVCQSLHCLPDGQA
VTLPLNENCELHMKSTPCSQALDVRLGFSLCQAELEFLQKRRVVAAQALKEVLQLEEDLR
ADEVPLIAIMATGGGTRSMTAMYGHLLALQKLNILNCASYITGLSGATWTMATLYRDPDW
SSKNLERAILEARRHVVKDKMPALFPDQLLKFEEELQQRRQEGYKVTFTDFWGLLIEACL
GDERNECKLSDQRAALCHGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGMQKYGAFI
PTELFGSEFFMGRLMKRIPESRMCYMLGLWSSIFSLNLLDAWNLSHTSEEFFHKWTRDRV
HDIEDEPLLPEIPKCDANVLDTTVVTPASWLSNTFRDILTHRAFVSKFHNFLLGLQLHTD
YLQNSQFSMWKDTVLDGFPNQLTGSVKHLCLLDTAFFVNSSYAPLLRPERKVDLIIHLNY
CAGSQTKPMKQTCEYCAVQNIPFLKYELQKEEDSLKECYLLENSQEPDTPIVTFFPLICD
TFQNYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEAAFDKLVKLSEYNILNNKDK
LLQALRLAVERKRQKSQCPP
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgactctccagacgtcggaaggccatcctggcttgggaacggatgtgtttgtccctcag
agccttcagtgggatgaagaaggcagcatggcaggaaggagtgtctgtgagtcagagcag
atacaggtcctggaaactccccatctcacatctctacttcccgtggcccctgatggctct
caggaggggctgtctccatgccacctgctgacagtgagggtcatccgcatgaagaacgtc
cgacaggccgacgtggtgagcctgacagactgcttcgtgagcctgtggctgcccactgcc
agtgaaaagaggctgaggactaggaccatctccaactgccgaaacccagaatggaatgag
accttcagcttccagatccagagccaagtgaagaatgttctagagctgagcgtctgtgat
gaagacacggtgacacctgatgaccatctcttgacagttctctatgacctcaccaagctc
tgcttccgaaagaaaacccacgtgaagttcccgctcaacacagagggcatggaggagctg
gaagtggagttcctgctggaggagagcccctctccacctgagagcctcatcacgaacggc
gtgctggtgtctcgacaaatgtcctgcctggaggtttgtgcagaatccaggaggccaaag
aagaggaaaaagaaggacctcctggtgacagtgacggagtccttcgagcacacccagcac
atctcaccctgcctggagtcctgctgctcaaaccttgcctgcttccaataccccaaatac
ttccagcctgaggtgcacgtggagttgcccaaaagcccgtggatctgtgagctttgctgc
tgtgcgcgccagaagggccctgtgtgccagtccctccactgcctccccgacggccaggca
gtgaccttgcctttgaatgagaactgtgaattacacatgaagtctacaccctgttcccag
gcgctggacgtgcggctgggcttcagcctgtgccaggcagaactggagttcctgcagaaa
cggagggtggtggcagcccaggcgctgaaggaggtgctgcagctggaggaggacctgcgg
gcagatgaggtcccgctgatagccatcatggccactgggggtggaacaagatctatgacc
gccatgtacggccacttgctggcgctgcagaagctgaacatcctgaactgtgccagctat
atcaccggcctgtctggggccacctggaccatggctaccttgtaccgtgaccctgactgg
tcctccaaaaacctggagcgtgccatcctcgaggcacggaggcacgtggtcaaggataag
atgcctgccctgttcccagaccagctcctcaaattcgaggaggagctccagcagcgcagg
caggaaggctacaaggtcaccttcacagacttctggggcctgctgattgaggcctgtctg
ggggatgagagaaatgaatgcaaactgtcagatcagcgtgctgctttgtgccatggccag
aaccccctgcccatctacctcaccatcaatgtcaaggatgatgtaagcaaccaggatttc
agagagtggttcgagttctccccctacgaggtgggcatgcagaagtatggagccttcatc
cccacagagctcttcggctccgagttcttcatggggcggctgatgaagagaatcccagag
tcgcggatgtgctacatgctaggtttgtggagtagcatcttctccctgaacctgcttgac
gcctggaacctatcccatacctcggaggagttttttcacaagtggacaagggatagagtg
catgatattgaagatgagccactcctgcctgaaatccccaaatgtgatgccaatgtcctg
gacaccacggtggtgacgccagcatcctggctgtccaacactttccgcgacatcctcacc
cacagggcctttgtctccaagttccacaatttcctgctggggctgcagctgcacaccgat
tacctccagaacagccagttctccatgtggaaagacacggtgctggacggcttcccaaac
cagctgacaggatctgtgaaacacctgtgcctgctggacaccgcattctttgtcaactcc
agctacgcgcccctcctcaggcctgagagaaaagttgacctcattatccaccttaattac
tgtgctgggtcccagacaaagcccatgaagcaaacctgtgagtactgtgccgtgcagaac
atccccttcctcaaatacgagctgcagaaggaggaggatagcctcaaggagtgctacctg
ctggagaactcccaggagcccgacacccccatcgtgacctttttcccactcatctgcgac
accttccaaaattacaaggccccaggtgtggaacgaagccccgaggagttggagcagggc
caggttgacatctacggtcccaaaactccctacgccaccaaggagctgacatacactgag
gctgccttcgacaagctggtgaagctttctgagtataacatcctgaataacaaggacaag
ctccttcaggccttgcgactggcagtagagaggaaacgccagaagagccagtgtcctccc
taa

DBGET integrated database retrieval system